BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00693 (781 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protei... 24 1.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 1.2 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 24 1.2 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 24 1.6 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 2.7 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 23 2.7 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 8.4 >L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protein protein. Length = 74 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 747 TRARHLYHHIATHTGRLPF 691 TR HL H+ HTG P+ Sbjct: 20 TRDHHLKTHMRLHTGERPY 38 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 744 RARHLYHHIATHTGRLPFV 688 + HL H+ HTG PFV Sbjct: 328 KTSHLKAHLRWHTGERPFV 346 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 747 TRARHLYHHIATHTGRLPF 691 TR HL H+ HTG P+ Sbjct: 173 TRDHHLKTHMRLHTGERPY 191 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 176 DRLSRVLDNDGAQDEGHG*RGRNPRGLRVFDKDGNGFI 289 + +S+ +D++ Q G+ GRN R RV ++ +GFI Sbjct: 181 EEVSKKIDDN--QKVGYVVEGRNYRKYRVEERTSDGFI 216 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -2 Query: 735 HLYHHIATHTGRLPFVPLQLNFSYIVK--LTEYFKS 634 HL +H+ H G PF + +++ + K L + KS Sbjct: 245 HLEYHLRNHAGSKPFQCNKCDYTCVNKSMLNSHMKS 280 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -2 Query: 735 HLYHHIATHTGRLPFVPLQLNFSYIVK--LTEYFKS 634 HL +H+ H G PF + +++ + K L + KS Sbjct: 3 HLEYHLRNHAGSKPFQCNKCDYTCVNKSMLNSHMKS 38 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 8.4 Identities = 12/40 (30%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -2 Query: 276 PSLSKTRRPR-GFLPRYPCPSSCAPSLSRTRESLSCRFRP 160 P + + P+ G P Y +PS T S + FRP Sbjct: 174 PQVQWSATPQAGSTPTYQTQGLLSPSYGGTTYSFTADFRP 213 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,488 Number of Sequences: 336 Number of extensions: 2717 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -