BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00692 (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 25 2.4 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 9.6 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 25.0 bits (52), Expect = 2.4 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = -3 Query: 685 PLHRYR*TLEVWLDHRARHPNLYQNFASQFTPKNRQIILVSWRHH 551 P+ YR E L HP L + + T K R I WRHH Sbjct: 336 PVDEYRLPFEAEL---GPHPTLEEMQDNVVTKKLRPRIFDPWRHH 377 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.0 bits (47), Expect = 9.6 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -2 Query: 182 SDWSYVSFAAKNSSKGNTRCRSRYCPILNVKSNFE 78 ++WS V AAK + RC C IL ++ E Sbjct: 1001 TNWSNVCEAAKRITSKLQRCWDDECAILAAQAMLE 1035 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 720,769 Number of Sequences: 2352 Number of extensions: 14093 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -