BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00692 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 3.9 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 5.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 5.1 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 22 6.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.8 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 22 6.8 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 21 9.0 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 9.0 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.6 bits (46), Expect = 3.9 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Frame = +1 Query: 112 YLDRH-----LVFPLLEFLAAKETYDQSELLQAKLEILSKTNMIDYVTDIRRISI 261 Y+ RH L ++ F A TY SEL++ E+ ++ + + + RI I Sbjct: 265 YMSRHENVSILYADIVGFTAISSTYSASELVKILNELFARFDQLSERFEQLRIKI 319 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.2 bits (45), Expect = 5.1 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 47 IHENKLS-T*VTQNLI*RLK*DSILIGISCFLY*NS*QQRRHMTSQSS 187 +HE + T + QN+I +K D +L +LY N+ T S+ Sbjct: 348 VHEKQQEITGLIQNIIQEMKNDVLLSNNDVYLYQNTMSNNNQRTEWSA 395 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.2 bits (45), Expect = 5.1 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 47 IHENKLS-T*VTQNLI*RLK*DSILIGISCFLY*NS*QQRRHMTSQSS 187 +HE + T + QN+I +K D +L +LY N+ T S+ Sbjct: 386 VHEKQQEITGLIQNIIQEMKNDVLLSNNDVYLYQNTMSNNNQRTEWSA 433 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 527 MLTPHNSTFIAIFGQTIHAID 465 +LTP ++ A+F +T+ ID Sbjct: 312 LLTPVSTMLPAVFAKTVSCID 332 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 6.8 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +3 Query: 417 INHLSTNKEYEFKI 458 +NHL T+ EY++++ Sbjct: 761 VNHLLTHHEYDYEL 774 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 527 MLTPHNSTFIAIFGQTIHAID 465 +LTP ++ A+F +T+ ID Sbjct: 312 LLTPVSTMLPAVFAKTVSCID 332 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 Query: 449 LILLVCRKMVYKS 411 LIL+ CRK V KS Sbjct: 59 LILITCRKRVSKS 71 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 652 KLREFIDNGGAVPLPATCKP 711 KL E GG++P P T P Sbjct: 145 KLVESFPRGGSLPTPVTPTP 164 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,234 Number of Sequences: 438 Number of extensions: 4417 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -