Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00690
         (736 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-3339|AAF56145.1|  540|Drosophila melanogaster CG10168-P...    31   1.2  

>AE014297-3339|AAF56145.1|  540|Drosophila melanogaster CG10168-PA
           protein.
          Length = 540

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 20/67 (29%), Positives = 35/67 (52%)
 Frame = -3

Query: 221 NSSIQNLIRDDKLWFTRIMQQIHRHACLWSGIRFYDIRFSNYRNSSIQNLIRDDKL*FTR 42
           N  +QNL+++D+  F   +    R   L S I FY++  +   N+ +Q L+RD  + F  
Sbjct: 81  NQLMQNLMKNDQ--FFDALGDKWREGVLVSTI-FYNVSHAILNNNGVQMLMRDKSIRFDM 137

Query: 41  ILQQIRH 21
           I+ +  H
Sbjct: 138 IMVEASH 144


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,976,040
Number of Sequences: 53049
Number of extensions: 561003
Number of successful extensions: 1166
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1142
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1166
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3314233461
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)