BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00689 (749 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 24 1.5 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 2.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.0 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 8.0 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 8.0 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 23.8 bits (49), Expect = 1.5 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Frame = -2 Query: 712 SALPSLRSTAILEPRHFG*RLQHVV------SVPSRNGHESDSSWVVANLLD 575 + LP++ ST +PR L+ VV P+RN E+D + L+D Sbjct: 218 TVLPNVNSTVYYDPRALSPNLEFVVLEAFDFYTPARNPKEADYPSPLYELVD 269 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = -1 Query: 308 GNIVLASFELPESNIDCDPTLTLSL*FVQYPSIFEG 201 GNI + + +P NI+ P + L+ + + + +G Sbjct: 151 GNIAMELWNMPRENIEPLPNVILACHMLSFLMVHQG 186 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -1 Query: 644 CCLRAIQKWARKRQQLGCSQSS*CMRIL 561 CC A+ RQ + S+ C+R + Sbjct: 615 CCYHAVAPGTDIRQSIALSRKKKCIRYM 642 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -1 Query: 644 CCLRAIQKWARKRQQLGCSQSS*CMRIL 561 CC A+ RQ + S+ C+R + Sbjct: 507 CCYHAVAPGTDIRQSIALSRKKKCIRYM 534 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 576 MYEDTSFLISSNLGSLYGGSVESFCLLL 493 ++ D S ++ LG Y G +CLL+ Sbjct: 262 LWVDLSHMMQQ-LGKAYSGMYSMYCLLI 288 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 576 MYEDTSFLISSNLGSLYGGSVESFCLLL 493 ++ D S ++ LG Y G +CLL+ Sbjct: 262 LWVDLSHMMQQ-LGKAYSGMYSMYCLLI 288 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,122 Number of Sequences: 336 Number of extensions: 4014 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -