BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00685 (722 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 24 1.7 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 23 2.2 AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin prot... 23 2.2 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 23 2.2 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 22 6.7 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 23.8 bits (49), Expect = 1.7 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Frame = -2 Query: 247 YRVSEVVNCNDLMTGFQQC----DYAMTSYVSAPPVTNMFLN-RGII 122 Y V E VN DLM QQC + Y S + FL+ RGI+ Sbjct: 61 YFVMEYVNGGDLMYQIQQCGKFKEPVAVFYASEIAIGLFFLHGRGIV 107 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -1 Query: 680 YRREIMFHLSSAALKSLEHFLDEVLRSAVNICDTSS 573 Y+R M KSLE LDE+ + D+ S Sbjct: 107 YKRAPMGFQGMRGKKSLEEILDEIKKKTTRFQDSRS 142 >AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin protein. Length = 215 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -1 Query: 680 YRREIMFHLSSAALKSLEHFLDEVLRSAVNICDTSS 573 Y+R M KSLE LDE+ + D+ S Sbjct: 107 YKRAPMGFQGMRGKKSLEEILDEIKKKTTRFQDSRS 142 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -1 Query: 680 YRREIMFHLSSAALKSLEHFLDEVLRSAVNICDTSS 573 Y+R M KSLE LDE+ + D+ S Sbjct: 107 YKRAPMGFQGMRGKKSLEEILDEIKKKTTRFQDSRS 142 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 238 SEVVNCNDLMTGFQ 197 S++ NCN LMT F+ Sbjct: 179 SDLDNCNHLMTKFE 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,678 Number of Sequences: 438 Number of extensions: 4166 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -