BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00683 (509 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0834 - 21626491-21626508,21626720-21626843,21626927-216270... 79 3e-15 08_02_0247 - 14753181-14753669,14754556-14754783,14755082-14755282 28 3.8 02_02_0576 + 11730171-11730466,11733096-11733435,11733530-117337... 27 6.6 >08_02_0834 - 21626491-21626508,21626720-21626843,21626927-21627012, 21627869-21627874 Length = 77 Score = 78.6 bits (185), Expect = 3e-15 Identities = 31/51 (60%), Positives = 42/51 (82%) Frame = +3 Query: 102 ERYNIHSQLEHLQSKYIGTGHADTTKYEWLMNQHRDSCCSYMGHPDLLSYF 254 +R+NI+SQLEHLQ+KY+GTGHAD ++EW +N RDS SY+GH +L+YF Sbjct: 5 DRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYIGHYPMLAYF 55 >08_02_0247 - 14753181-14753669,14754556-14754783,14755082-14755282 Length = 305 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +2 Query: 206 RLLLQLHGSSGFVELLSIVENESKARVKFNLMERML 313 R LLQ+ G+SGF+ LL + + + KF+ +E L Sbjct: 2 RDLLQVAGASGFLSLLLLPRATDETQTKFHSLEDTL 37 >02_02_0576 + 11730171-11730466,11733096-11733435,11733530-11733748, 11734687-11734746,11734847-11735096,11735314-11735441 Length = 430 Score = 27.5 bits (58), Expect = 6.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 300 IKLNFTRALDSFSTIESNSTNPDDPCNCSKSRD 202 + L AL +T+ NP++PC C SRD Sbjct: 176 VDLAGVEALADANTVAMVIVNPNNPCGCVYSRD 208 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,232,081 Number of Sequences: 37544 Number of extensions: 195914 Number of successful extensions: 424 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1095026320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -