BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00682 (702 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.09c |||GTPase activating protein |Schizosaccharomyces po... 27 2.6 SPBC20F10.08c |||conserved eukaryotic protein|Schizosaccharomyce... 27 3.4 SPBC15D4.14 |taf73||TATA-binding protein associated factor |Schi... 26 4.5 SPBP4H10.20 |nhm1|DcpS|m7G|Schizosaccharomyces pombe|chr 2|||Manual 26 4.5 SPBC776.07 |||mitochondrial Mam33 family protein|Schizosaccharom... 25 7.9 >SPAC824.09c |||GTPase activating protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 320 Score = 27.1 bits (57), Expect = 2.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 Query: 110 CLRAHGVHQSSGVHI 154 C+R GVH+S GVH+ Sbjct: 49 CIRCSGVHRSLGVHV 63 >SPBC20F10.08c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 747 Score = 26.6 bits (56), Expect = 3.4 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 51 LLEEKGISNEFVQKLSDFSTAYEHTAYINLLESISK 158 LL +K S ++KL D + ++NLLE ISK Sbjct: 13 LLNQKNDSRPVIEKLKDNISGDLLNYFLNLLEEISK 48 >SPBC15D4.14 |taf73||TATA-binding protein associated factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 642 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 412 DTYKIKAKTVRVNIYLYSYIRLLTNGEKSFETLYFQT 522 D YK K + V I+++SY+ LL + +F++ Sbjct: 76 DLYKPKLQKVLYPIFVHSYLDLLQKNDPEMAIYFFES 112 >SPBP4H10.20 |nhm1|DcpS|m7G|Schizosaccharomyces pombe|chr 2|||Manual Length = 304 Score = 26.2 bits (55), Expect = 4.5 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 188 TKILNNIQTFHFFLNTLFQ 244 TK++ N FH+FL+T FQ Sbjct: 67 TKLVENNDVFHWFLSTNFQ 85 >SPBC776.07 |||mitochondrial Mam33 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 269 Score = 25.4 bits (53), Expect = 7.9 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 54 LEEKGISNEFVQKLSDFSTAYEHTAYINLLESISKF 161 LEE+ I + F E YIN LES+ +F Sbjct: 232 LEERKIDESLSSFIVSFGLTKELKEYINWLESVRQF 267 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,669,241 Number of Sequences: 5004 Number of extensions: 53221 Number of successful extensions: 136 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -