BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00682 (702 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0532 + 18386593-18386722,18386826-18386900,18387098-183875... 29 2.7 03_06_0653 - 35305279-35306163 29 3.6 >09_04_0532 + 18386593-18386722,18386826-18386900,18387098-18387510, 18387682-18387688,18387944-18388005,18388046-18388341, 18388456-18388813,18388916-18389491,18389956-18390231 Length = 730 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 550 SHKSPKHYLILTIIRHIKRAKHKLLLSLTNKKTYFNTFNVK 672 SHK +YL + + + H L L LTN+ Y N+ N K Sbjct: 370 SHKKETNYLAQVAAKSLPKGLHCLPLRLTNEYYYTNSNNKK 410 >03_06_0653 - 35305279-35306163 Length = 294 Score = 29.1 bits (62), Expect = 3.6 Identities = 18/43 (41%), Positives = 21/43 (48%) Frame = +1 Query: 58 KKRA*AMNSCRSCQTSVLPTSTRRTSIFWSPYLNSPSENNVTS 186 KKR A C+TS P +TRRT W P L S E +S Sbjct: 249 KKRNSAAVPSTGCRTSRAPATTRRT---WEPSLPSVEEERESS 288 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,266,221 Number of Sequences: 37544 Number of extensions: 269331 Number of successful extensions: 501 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -