BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00682 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66440.1 68414.m07548 DC1 domain-containing protein contains ... 29 3.9 At5g46470.1 68418.m05723 disease resistance protein (TIR-NBS-LRR... 27 9.1 At5g16800.2 68418.m01967 GCN5-related N-acetyltransferase (GNAT)... 27 9.1 At5g16800.1 68418.m01968 GCN5-related N-acetyltransferase (GNAT)... 27 9.1 >At1g66440.1 68414.m07548 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 726 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 400 LLLLIEDLKSTNAAQCNCQNSRHLL*MYYCWIC 302 L L++E+ +C C + L YYCW+C Sbjct: 236 LQLILENSWGCRKKKCYCCDEILLWIFYYCWVC 268 >At5g46470.1 68418.m05723 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1127 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -2 Query: 215 MFVCYLKF*FEVTLFSDGEFRYGLQKIDVR 126 +F CY F E T F DG+F Y I R Sbjct: 1032 VFDCYFPFNEEFTTFLDGQFNYDHVDIQFR 1061 >At5g16800.2 68418.m01967 GCN5-related N-acetyltransferase (GNAT) family protein very low similarity to SP|P39909 Spermine/spermidine acetyltransferase (EC 2.3.1.57) {Bacillus subtilis}; contains Pfam profile PF00583: acetyltransferase, GNAT family Length = 270 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +1 Query: 268 SVQLKFRKS-NCYRSNNSTFIINGGNFDSYIVLHLL 372 +++L R S C R + ++ING +FDSY+ ++ + Sbjct: 162 AIRLYKRMSFRCVRRLHGFYLINGQHFDSYLFVYFI 197 >At5g16800.1 68418.m01968 GCN5-related N-acetyltransferase (GNAT) family protein very low similarity to SP|P39909 Spermine/spermidine acetyltransferase (EC 2.3.1.57) {Bacillus subtilis}; contains Pfam profile PF00583: acetyltransferase, GNAT family Length = 236 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +1 Query: 268 SVQLKFRKS-NCYRSNNSTFIINGGNFDSYIVLHLL 372 +++L R S C R + ++ING +FDSY+ ++ + Sbjct: 162 AIRLYKRMSFRCVRRLHGFYLINGQHFDSYLFVYFI 197 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,134,116 Number of Sequences: 28952 Number of extensions: 246606 Number of successful extensions: 467 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 467 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -