BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00678 (746 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1206 + 31727931-31728048,31728492-31728538,31728782-317289... 36 0.045 03_05_0728 - 27174157-27174408,27175316-27175364,27175454-271755... 28 9.1 >04_04_1206 + 31727931-31728048,31728492-31728538,31728782-31728906, 31729067-31729133,31729221-31729283,31729429-31729498, 31729751-31729770,31729840-31729956,31730046-31730227, 31730586-31730640,31731604-31731697,31731791-31731900, 31733167-31733193,31733510-31733701 Length = 428 Score = 35.5 bits (78), Expect = 0.045 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 52 ISRGHALITGPRVHRCERLWMWL 120 I+RGH + R+ RC RLW WL Sbjct: 252 ITRGHVVTESDRIRRCSRLWRWL 274 >03_05_0728 - 27174157-27174408,27175316-27175364,27175454-27175536, 27175673-27175753,27175838-27175894,27176103-27176202, 27176280-27176350,27176427-27176567,27176657-27176863, 27177442-27177612,27177735-27177815,27177887-27177940, 27178040-27178154,27178302-27178441,27178976-27179197, 27179278-27179376,27179461-27179580,27179776-27179981, 27180072-27180249,27180426-27180486,27180587-27180696, 27180765-27180896,27181124-27181165,27181592-27181762, 27181806-27181808,27181848-27181974,27182130-27182164, 27182982-27183083,27183167-27183224,27183314-27183415, 27183513-27183659,27183744-27183880,27183973-27184122, 27184234-27184393,27184930-27185075,27185162-27185305, 27185535-27185663,27186376-27186420,27187103-27187192, 27187473-27187475 Length = 1506 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 653 GALRTSITSCIRRETNLKKDREYDIRHNARLIYL 552 G L + C+RRE + K ++ RH AR+ YL Sbjct: 758 GTLARKLYECMRREASAVKIQKNVRRHKARVSYL 791 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,972,162 Number of Sequences: 37544 Number of extensions: 278448 Number of successful extensions: 446 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -