Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00678
         (746 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g26000.1 68415.m03122 zinc finger (C3HC4-type RING finger) fa...    29   3.3  

>At2g26000.1 68415.m03122 zinc finger (C3HC4-type RING finger)
           family protein similar to BRCA1-associated protein 2
           [Homo sapiens] GI:3252872; contains Pfam profiles
           PF00097: Zinc finger, C3HC4 type (RING finger), PF02148:
           Zn-finger in ubiquitin-hydrolases and other protein
          Length = 461

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 2/44 (4%)
 Frame = -1

Query: 197 HSSRHFDHSLHCHSRKESARRLNNSL--NHIHSLSQRWTRGPVI 72
           H+ RH++ + HC+S +   +R+ +    N++H L Q  T G ++
Sbjct: 245 HARRHWEETEHCYSLELETQRVWDYAGDNYVHRLIQSKTDGKLV 288


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,181,080
Number of Sequences: 28952
Number of extensions: 233771
Number of successful extensions: 425
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 421
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 425
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1653386488
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)