BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00677 (728 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0531 + 18256597-18256836,18257637-18257735,18258038-182581... 30 1.6 >08_02_0531 + 18256597-18256836,18257637-18257735,18258038-18258184, 18258295-18258427,18258521-18258585,18258792-18258962, 18259095-18259199,18259495-18259602,18259792-18260088, 18260191-18260256,18260477-18260679,18261178-18261232, 18261318-18261503,18261701-18261985 Length = 719 Score = 30.3 bits (65), Expect = 1.6 Identities = 21/69 (30%), Positives = 36/69 (52%) Frame = -3 Query: 315 NSHLSSQLDDSKILTTEN*VNVAEVTSLSNSVINCLLLTYFYKNK*NSVCD*LIK*VF*T 136 NS L L+ S +TT N +++ S+ ++ LL+TYF +N V D +++ + + Sbjct: 518 NSRLRRALEQS--MTTLNRMSLDSDNSVDRRIVIKLLVTYFQRNHSKEVLDLMVRMLGFS 575 Query: 135 PLPKQGNGF 109 KQ GF Sbjct: 576 EEDKQRIGF 584 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,991,300 Number of Sequences: 37544 Number of extensions: 350805 Number of successful extensions: 603 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -