BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00676 (709 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC890.02c |alp7|mia1|TACC homolog |Schizosaccharomyces pombe|c... 29 0.65 SPBP35G2.10 |mit1||SHREC complex subunit Mit1|Schizosaccharomyce... 27 2.0 SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharo... 27 3.5 SPAPB1A10.06c |||ATP-dependent RNA helicase Dhr1 |Schizosaccharo... 27 3.5 SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytoch... 26 6.1 >SPAC890.02c |alp7|mia1|TACC homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 29.1 bits (62), Expect = 0.65 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 Query: 216 TPEPTYDKENVVAIFTLKNPKIFS 287 TPE + K NV +I T KNP +FS Sbjct: 116 TPEFKHRKRNVESILTPKNPSLFS 139 >SPBP35G2.10 |mit1||SHREC complex subunit Mit1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1418 Score = 27.5 bits (58), Expect = 2.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 569 SNGDSVGRGDSRADKFSLGVKFHSA 495 SNG V R +R KF G +FH A Sbjct: 103 SNGSKVLRDSTRTKKFKFGKEFHCA 127 >SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 26.6 bits (56), Expect = 3.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 129 NPNPEETSETKSVEDFNVAANAMVETEAITPEP 227 NP+PE+T +SVE V +N + + + P P Sbjct: 216 NPSPEDTVAFQSVELQKVISNNRLNSSSTPPTP 248 >SPAPB1A10.06c |||ATP-dependent RNA helicase Dhr1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1183 Score = 26.6 bits (56), Expect = 3.5 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 411 PKTKISTSFKTTGFLLRQKNSNYLLTLLSRV 503 P T I F T G LLR+ +S++LLT S V Sbjct: 491 PDTAIK--FMTDGILLRELSSDFLLTAYSAV 519 >SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytochrome c oxidase assembly protein Cox1101, mitochondrial ribosomal protein Rsm22|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 25.8 bits (54), Expect = 6.1 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +1 Query: 364 RFACSFTSASCITSSDPKPKFRRASKQQDFFSGKRIRI 477 RF C FTS SC K+ R + F +R I Sbjct: 534 RFPCIFTSFSCYNCISGTRKYSRQYSRDKFHYNQRTTI 571 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,625,840 Number of Sequences: 5004 Number of extensions: 51087 Number of successful extensions: 190 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -