BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00673 (732 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1434 - 33568258-33569415 29 3.8 07_03_0375 + 17408815-17409035,17422820-17423477,17423780-174241... 28 8.8 01_06_1317 - 36251231-36251341,36252514-36252609,36252879-362529... 28 8.8 >04_04_1434 - 33568258-33569415 Length = 385 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 533 DMDFYIFNDIIY**TTRVVYYINTIIIPKHDHAVR 637 +M FY FN I+Y R +Y +NTI + + A++ Sbjct: 132 EMPFYWFNFIVYDDADRRMYCVNTIFVVRLARAIQ 166 >07_03_0375 + 17408815-17409035,17422820-17423477,17423780-17424161, 17424236-17424550,17424727-17425118,17432479-17432508 Length = 665 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/44 (25%), Positives = 26/44 (59%) Frame = +2 Query: 359 VILYVPCAILKFYSLKRIIIFHMVFLFKHYMF*RERFMRNLGGP 490 +++++ C ++K S+ + H +F F+ YM ++++RN P Sbjct: 585 IMMHLLCHLVKEISILGPVYLHNMFPFERYMGVLKKYVRNRARP 628 >01_06_1317 - 36251231-36251341,36252514-36252609,36252879-36252956, 36253037-36253138,36254509-36254784 Length = 220 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 67 IYTLRRGGDFCDWTHKFFGPGNFKIFHMFIGFA 165 I+ ++R C W + G N+KIF +F+ +A Sbjct: 86 IHEIKRKDHHCIWINNCVGHENYKIFLVFVLYA 118 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,670,880 Number of Sequences: 37544 Number of extensions: 256992 Number of successful extensions: 481 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -