BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00667 (627 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0475 + 9724676-9724936,9725518-9726216,9726273-9726596,972... 29 3.0 10_06_0060 + 10184165-10185002,10185084-10185167,10185262-10186334 27 9.2 04_04_1509 - 34074206-34074398,34074506-34074777,34075411-340756... 27 9.2 >09_02_0475 + 9724676-9724936,9725518-9726216,9726273-9726596, 9726900-9727847 Length = 743 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -1 Query: 216 KVLRSNRQPGDDSAILIYGILGLLKSTLLSFHYQEKEQG 100 K L S P D S + I G+ GL K++L +++KE+G Sbjct: 130 KDLLSQSNPDDLSILPIVGLPGLGKTSLARLVFEDKEEG 168 >10_06_0060 + 10184165-10185002,10185084-10185167,10185262-10186334 Length = 664 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 497 MNIAVSLVPK*NLIEVHSTLHTFRFDCRIPNVFKNDS 607 +NIA+ L ++ H T TF D + +VF +D+ Sbjct: 477 VNIAIELASALTYLQAHDTAPTFLHDLKSSDVFLDDN 513 >04_04_1509 - 34074206-34074398,34074506-34074777,34075411-34075608, 34076092-34076187,34076318-34076500,34076597-34076799, 34076887-34077013,34077098-34077292,34077400-34077540, 34077669-34077812,34077876-34078040,34078776-34078976, 34079049-34079195,34079275-34079427,34079731-34079833, 34079954-34080069,34080168-34080349,34080442-34080541, 34081200-34081527,34081605-34081834,34081979-34082110, 34082787-34082859,34083274-34083338 Length = 1248 Score = 27.5 bits (58), Expect = 9.2 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -1 Query: 525 FGTNETAIFIKSKLAFALEVYEF 457 FG++ TA+F K ++A L +++F Sbjct: 517 FGSSNTAVFFKMRVAGVLHIFQF 539 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,115,565 Number of Sequences: 37544 Number of extensions: 218321 Number of successful extensions: 391 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -