BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00666 (635 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01700.1 68414.m00088 expressed protein contains Pfam profile... 28 6.0 At3g50050.1 68416.m05472 aspartyl protease family protein contai... 27 7.9 >At1g01700.1 68414.m00088 expressed protein contains Pfam profile PF03759: Domain of unknown function (DUF315) Length = 485 Score = 27.9 bits (59), Expect = 6.0 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +3 Query: 12 KHIKCEGLDHNDYDVLSSLDMETMYDDITKTLSGEDRSHANR 137 KH + E +H +S ++ETM + +K L GED S + + Sbjct: 97 KHNQIETDEHLAVQEISEPELETMKERFSKLLLGEDMSGSGK 138 >At3g50050.1 68416.m05472 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease Length = 632 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 242 LHPRDGECVSRRVLRLYDPPDVAGYFDTCVW 334 LH D + + +RLYD + GY+ T +W Sbjct: 68 LHKSDSKSLPHSRMRLYDDLLINGYYTTRLW 98 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,070,030 Number of Sequences: 28952 Number of extensions: 224657 Number of successful extensions: 435 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 435 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -