BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00660 (793 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53470.1 68418.m06645 acyl-CoA binding protein, putative / AC... 66 3e-11 At4g27780.1 68417.m03990 acyl-CoA binding protein 2 (ACBP2) iden... 59 3e-09 At1g31812.1 68414.m03905 acyl-CoA binding protein / ACBP identic... 58 9e-09 At3g05420.2 68416.m00594 acyl-CoA binding family protein similar... 54 1e-07 At3g05420.1 68416.m00593 acyl-CoA binding family protein similar... 54 1e-07 At5g27630.1 68418.m03310 acyl-CoA binding family protein similar... 51 1e-06 At4g24230.2 68417.m03478 acyl-CoA binding protein, putative / AC... 50 2e-06 At4g24230.1 68417.m03477 acyl-CoA binding protein, putative / AC... 50 2e-06 At2g25600.1 68415.m03066 potassium channel protein, putative sim... 37 0.013 At3g59830.1 68416.m06676 ankyrin protein kinase, putative simila... 35 0.071 At2g31800.1 68415.m03882 ankyrin protein kinase, putative simila... 34 0.094 At5g20350.1 68418.m02421 zinc finger (DHHC type) family protein ... 33 0.16 At4g32500.1 68417.m04626 potassium channel protein, putative sim... 33 0.22 At2g43850.2 68415.m05452 ankyrin protein kinase, putative (APK1)... 33 0.22 At2g43850.1 68415.m05451 ankyrin protein kinase, putative (APK1)... 33 0.22 At2g17390.1 68415.m02008 ankyrin repeat family protein contains ... 33 0.22 At4g35450.4 68417.m05039 ankyrin repeat family protein / AFT pro... 33 0.29 At4g35450.3 68417.m05038 ankyrin repeat family protein / AFT pro... 33 0.29 At4g35450.2 68417.m05037 ankyrin repeat family protein / AFT pro... 33 0.29 At4g35450.1 68417.m05036 ankyrin repeat family protein / AFT pro... 33 0.29 At2g03430.1 68415.m00301 ankyrin repeat family protein contains ... 32 0.38 At2g47450.1 68415.m05922 chloroplast signal recognition particle... 31 0.66 At5g12320.1 68418.m01448 ankyrin repeat family protein contains ... 31 1.2 At2g14250.1 68415.m01592 ankyrin repeat family protein contains ... 31 1.2 At4g19150.1 68417.m02825 ankyrin repeat family protein contains ... 30 1.5 At3g03790.2 68416.m00389 ankyrin repeat family protein / regulat... 30 1.5 At3g03790.1 68416.m00388 ankyrin repeat family protein / regulat... 30 1.5 At3g01750.1 68416.m00112 ankyrin repeat family protein contains ... 30 1.5 At2g41520.2 68415.m05131 DNAJ heat shock N-terminal domain-conta... 30 1.5 At2g41520.1 68415.m05130 DNAJ heat shock N-terminal domain-conta... 30 1.5 At3g04710.1 68416.m00505 ankyrin repeat family protein contains ... 30 2.0 At2g04740.1 68415.m00484 ankyrin repeat family protein contains ... 30 2.0 At3g59050.1 68416.m06582 amine oxidase family protein similar to... 29 2.7 At5g28810.1 68418.m03542 hypothetical protein 29 4.7 At5g14230.1 68418.m01663 ankyrin repeat family protein contains ... 29 4.7 At4g39210.1 68417.m05551 glucose-1-phosphate adenylyltransferase... 29 4.7 At5g07270.1 68418.m00829 ankyrin repeat family protein contains ... 28 6.2 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 28 6.2 At3g12360.1 68416.m01541 ankyrin repeat family protein contains ... 28 6.2 At5g54070.1 68418.m06731 heat shock transcription factor family ... 28 8.2 At5g49780.1 68418.m06165 leucine-rich repeat transmembrane prote... 28 8.2 At2g43030.1 68415.m05340 ribosomal protein L3 family protein con... 28 8.2 >At5g53470.1 68418.m06645 acyl-CoA binding protein, putative / ACBP, putative similar to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 338 Score = 65.7 bits (153), Expect = 3e-11 Identities = 33/87 (37%), Positives = 47/87 (54%), Gaps = 5/87 (5%) Frame = +2 Query: 8 SPDSDFSDEDQSPLDSLFNKAADHLR-----KITNKLDNGQLLELYGLFKQGTEGQCNTP 172 S D D+ + + LD F+ A + +++ K+ N L+LYGL+K TEG C P Sbjct: 81 SDDDDWEGVESTELDEAFSAATAFVAAAASDRLSQKVSNELQLQLYGLYKIATEGPCTAP 140 Query: 173 KPGWLDGKGRRKWEAWKNLKDMPSEEA 253 +P L R KW+AW+ L MP EEA Sbjct: 141 QPSALKMTARAKWQAWQKLGAMPPEEA 167 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSC 623 WA DR +N A + ++A D GQT+LHYAV C Sbjct: 257 WAIDRGHLNVAEALVDKNADVNAKDNEGQTSLHYAVVC 294 Score = 32.3 bits (70), Expect = 0.38 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 516 ADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 A + L + G P++A D G+T LH+A+ GH+ + L Sbjct: 226 AREGEVENLLKCIENGIPVNARDSEGRTPLHWAIDRGHLNVAEAL 270 >At4g27780.1 68417.m03990 acyl-CoA binding protein 2 (ACBP2) identical to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 354 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 5/85 (5%) Frame = +2 Query: 14 DSDFSDEDQSPLDSLFNKAADHLR-----KITNKLDNGQLLELYGLFKQGTEGQCNTPKP 178 D D+ + + LD F+ A + +++ K+ + +LYGL+K TEG C P+P Sbjct: 93 DDDWEGVESTELDEAFSAATLFVTTAAADRLSQKVPSDVQQQLYGLYKIATEGPCTAPQP 152 Query: 179 GWLDGKGRRKWEAWKNLKDMPSEEA 253 L R KW+AW+ L MP EEA Sbjct: 153 SALKMTARAKWQAWQKLGAMPPEEA 177 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILDESWSYTA 674 WA DR +N + ++A D GQT LHYAV C + L + + TA Sbjct: 272 WAIDRGHLNIAKVLVDKNADVNAKDNEGQTPLHYAVVCDREAIAEFLVKQNANTA 326 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +3 Query: 516 ADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 A + L ++ G P++A D G+T LH+A+ GH+ K+L Sbjct: 241 AREGEVENLLKSIESGIPVNARDSEGRTPLHWAIDRGHLNIAKVL 285 >At1g31812.1 68414.m03905 acyl-CoA binding protein / ACBP identical to acyl-CoA-binding protein (ACBP) [Arabidopsis thaliana] SWISS-PROT:P57752 Length = 92 Score = 57.6 bits (133), Expect = 9e-09 Identities = 28/77 (36%), Positives = 42/77 (54%) Frame = +2 Query: 59 FNKAADHLRKITNKLDNGQLLELYGLFKQGTEGQCNTPKPGWLDGKGRRKWEAWKNLKDM 238 F + A+ + +T N LL LYGL+KQ G +T +PG K R KW+AWK ++ Sbjct: 7 FEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGK 66 Query: 239 PSEEARRNILLC*KNMI 289 SEEA + + K ++ Sbjct: 67 SSEEAMNDYITKVKQLL 83 >At3g05420.2 68416.m00594 acyl-CoA binding family protein similar to PIR|S68824|S68824 rngB protein, cytosolic (Dictyostelium discoideum); contains Pfam profiles PF00887: Acyl CoA binding protein, PF01344: Kelch motif Length = 669 Score = 53.6 bits (123), Expect = 1e-07 Identities = 24/59 (40%), Positives = 34/59 (57%) Frame = +2 Query: 83 RKITNKLDNGQLLELYGLFKQGTEGQCNTPKPGWLDGKGRRKWEAWKNLKDMPSEEARR 259 + + +K + L LY L++Q T G CNTPKP + KW++W+ L MPS EA R Sbjct: 33 KNVISKFPDDTALLLYALYQQATVGPCNTPKPSAWRPVEQSKWKSWQGLGTMPSIEAMR 91 >At3g05420.1 68416.m00593 acyl-CoA binding family protein similar to PIR|S68824|S68824 rngB protein, cytosolic (Dictyostelium discoideum); contains Pfam profiles PF00887: Acyl CoA binding protein, PF01344: Kelch motif Length = 668 Score = 53.6 bits (123), Expect = 1e-07 Identities = 24/59 (40%), Positives = 34/59 (57%) Frame = +2 Query: 83 RKITNKLDNGQLLELYGLFKQGTEGQCNTPKPGWLDGKGRRKWEAWKNLKDMPSEEARR 259 + + +K + L LY L++Q T G CNTPKP + KW++W+ L MPS EA R Sbjct: 33 KNVISKFPDDTALLLYALYQQATVGPCNTPKPSAWRPVEQSKWKSWQGLGTMPSIEAMR 91 >At5g27630.1 68418.m03310 acyl-CoA binding family protein similar to RING finger rngB protein, cytosolic - Dictyostelium discoideum, PIR:S68824; contains Pfam profiles PF01344: Kelch motif, PF00887: Acyl CoA binding protein (ACBP) Length = 648 Score = 50.8 bits (116), Expect = 1e-06 Identities = 23/60 (38%), Positives = 36/60 (60%) Frame = +2 Query: 80 LRKITNKLDNGQLLELYGLFKQGTEGQCNTPKPGWLDGKGRRKWEAWKNLKDMPSEEARR 259 ++++++K N L LY L +Q T G C+ PKP + + KW++W+ L MPS EA R Sbjct: 33 VKQLSSKFSNDTSLLLYTLHQQATLGPCSIPKPSAWNPVEQSKWKSWQGLGTMPSIEAMR 92 >At4g24230.2 68417.m03478 acyl-CoA binding protein, putative / ACBP, putative contains similarity to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 362 Score = 50.0 bits (114), Expect = 2e-06 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 2/87 (2%) Frame = +2 Query: 14 DSDFSDEDQSPLDSLFNKAADHLRKITNKLDNGQ--LLELYGLFKQGTEGQCNTPKPGWL 187 D D+ ++S L+ F A + L + + G +EL+GL K TEG C +P + Sbjct: 220 DDDWEGIERSELEKAFAAAVNLLEESGKAEEIGAEAKMELFGLHKIATEGSCREAQPMAV 279 Query: 188 DGKGRRKWEAWKNLKDMPSEEARRNIL 268 R KW AW+ L +M EEA L Sbjct: 280 MISARAKWNAWQKLGNMSQEEAMEQYL 306 >At4g24230.1 68417.m03477 acyl-CoA binding protein, putative / ACBP, putative contains similarity to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 364 Score = 50.0 bits (114), Expect = 2e-06 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 2/87 (2%) Frame = +2 Query: 14 DSDFSDEDQSPLDSLFNKAADHLRKITNKLDNGQ--LLELYGLFKQGTEGQCNTPKPGWL 187 D D+ ++S L+ F A + L + + G +EL+GL K TEG C +P + Sbjct: 220 DDDWEGIERSELEKAFAAAVNLLEESGKAEEIGAEAKMELFGLHKIATEGSCREAQPMAV 279 Query: 188 DGKGRRKWEAWKNLKDMPSEEARRNIL 268 R KW AW+ L +M EEA L Sbjct: 280 MISARAKWNAWQKLGNMSQEEAMEQYL 306 >At2g25600.1 68415.m03066 potassium channel protein, putative similar to potassium channel [Lycopersicon esculentum] GI:8980432; member of the 1 pore, 6 transmembrane (1P/6TM- Shaker-type) K+ channel family, PMID:11500563; Shaker Pollen Inward K+ Channel (SPIK) PMID:11825875 Length = 888 Score = 37.1 bits (82), Expect = 0.013 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +3 Query: 513 AADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 A ++N ++AL + G + D G TALH AVS GH+E K L Sbjct: 648 AVEKNCLDALKDIIKYGGDVTLPDGNGTTALHRAVSEGHLEIVKFL 693 >At3g59830.1 68416.m06676 ankyrin protein kinase, putative similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674 Length = 477 Score = 34.7 bits (76), Expect = 0.071 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +3 Query: 516 ADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 A + +N + L+ G ++++D G+TALH A GH + K+L Sbjct: 84 ASKGDVNGVEELLNEGIDVNSIDLDGRTALHIASCEGHYDVVKVL 128 >At2g31800.1 68415.m03882 ankyrin protein kinase, putative similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674; contains Pfam profile PF00023: Ankyrin repeat; identical to cDNA calcineurin B-like protein 10 (CBL10) GI:29150247; blastp match of 67% identity and 1.9e-200 P-value to GP|18700701|gb|AAL78674.1|AF458699_1|AF458699 ankyrin-kinase {Medicago truncatula} Length = 476 Score = 34.3 bits (75), Expect = 0.094 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 + A R + + L G ++++D G+TALH A GHV+ K+L Sbjct: 81 FVACRGDVEGVQDLLDEGIDVNSIDLDGRTALHIAACEGHVDVVKLL 127 >At5g20350.1 68418.m02421 zinc finger (DHHC type) family protein / ankyrin repeat family protein similar to patsas protein [Drosophila melanogaster] GI:6002770; contains Pfam profiles PF00023: Ankyrin repeat, PF01529: DHHC zinc finger domain Length = 592 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 W+A N + + G ++A D GQTALH++ G ++ ++L Sbjct: 71 WSALNNRVAVAQYLIEHGGDVNATDHTGQTALHWSAVRGAIQVAELL 117 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCG 626 W+A R AI L G +DA D G A H A G Sbjct: 104 WSAVRGAIQVAELLLQEGARVDATDMYGYQATHVAAQYG 142 >At4g32500.1 68417.m04626 potassium channel protein, putative similar to potassium channel [Solanum tuberosum] gi|1514649|emb|CAA60016; similar to AKT1 [Arabidopsis thaliana] gi|563112|gb|AAA96810; member of the 1 pore, 6 transmembrane (1P/6TM- Shaker-type) K+ channel family, PMID:11500563 Length = 880 Score = 33.1 bits (72), Expect = 0.22 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +3 Query: 513 AADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILDE 656 A +N +NAL + G I D G TALH AVS G++E + L E Sbjct: 646 AVGQNNLNALKDIVKYGGDISLSDVNGTTALHRAVSEGNLEIVQFLLE 693 >At2g43850.2 68415.m05452 ankyrin protein kinase, putative (APK1) similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674;contains Pfam profile PF00069: Protein kinase domain; contains Pfam profile PF00023: Ankyrin repeat Length = 479 Score = 33.1 bits (72), Expect = 0.22 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = +3 Query: 426 LRRASEGT-SDQEAGIEI*ERRRWPHCTTWAADRNAINALSAALSGGCPIDAVDECGQTA 602 +RR+ + + SD E + + E + A + + + L G ++++D G+TA Sbjct: 55 IRRSPDSSKSDDEPHMSVPENLDSTMQLLFMASKGDVRGIEELLDEGIDVNSIDLDGRTA 114 Query: 603 LHYAVSCGHVESTKIL 650 LH A GH+ K L Sbjct: 115 LHIAACEGHLGVVKAL 130 >At2g43850.1 68415.m05451 ankyrin protein kinase, putative (APK1) similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674;contains Pfam profile PF00069: Protein kinase domain; contains Pfam profile PF00023: Ankyrin repeat Length = 479 Score = 33.1 bits (72), Expect = 0.22 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = +3 Query: 426 LRRASEGT-SDQEAGIEI*ERRRWPHCTTWAADRNAINALSAALSGGCPIDAVDECGQTA 602 +RR+ + + SD E + + E + A + + + L G ++++D G+TA Sbjct: 55 IRRSPDSSKSDDEPHMSVPENLDSTMQLLFMASKGDVRGIEELLDEGIDVNSIDLDGRTA 114 Query: 603 LHYAVSCGHVESTKIL 650 LH A GH+ K L Sbjct: 115 LHIAACEGHLGVVKAL 130 >At2g17390.1 68415.m02008 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 344 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 531 INALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 + L AAL+ G D D G+TALH+A G V ++L Sbjct: 233 VEGLKAALASGGNKDEEDSEGRTALHFACGYGEVRCAQVL 272 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILDES 659 +A + L G +A+D+ T LHYA G E +L E+ Sbjct: 259 FACGYGEVRCAQVLLDAGANANAIDKNKNTPLHYAAGYGRKECVSLLLEN 308 >At4g35450.4 68417.m05039 ankyrin repeat family protein / AFT protein (AFT) contains ankyrin repeats, Pfam:PF00023; identical to cDNA AFT protein (AFT) GI:3478699 Length = 304 Score = 32.7 bits (71), Expect = 0.29 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 1/88 (1%) Frame = +3 Query: 531 INALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL-DESWSYTAXXXXXXHSIRP 707 + L AAL+ G D D G+TALH+A G ++ ++L D S A + Sbjct: 193 VEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPLHY 252 Query: 708 GY*Y*NKKMLEVLINLAFSRFIMDVDFK 791 Y K+ + +L+ + + ++D K Sbjct: 253 AAGYGRKECVSLLLENGAAVTLQNLDEK 280 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILDES 659 +A + + G ++AVD+ T LHYA G E +L E+ Sbjct: 219 FACGYGELKCAQVLIDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLEN 268 >At4g35450.3 68417.m05038 ankyrin repeat family protein / AFT protein (AFT) contains ankyrin repeats, Pfam:PF00023; identical to cDNA AFT protein (AFT) GI:3478699 Length = 342 Score = 32.7 bits (71), Expect = 0.29 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 1/88 (1%) Frame = +3 Query: 531 INALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL-DESWSYTAXXXXXXHSIRP 707 + L AAL+ G D D G+TALH+A G ++ ++L D S A + Sbjct: 231 VEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPLHY 290 Query: 708 GY*Y*NKKMLEVLINLAFSRFIMDVDFK 791 Y K+ + +L+ + + ++D K Sbjct: 291 AAGYGRKECVSLLLENGAAVTLQNLDEK 318 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILDES 659 +A + + G ++AVD+ T LHYA G E +L E+ Sbjct: 257 FACGYGELKCAQVLIDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLEN 306 >At4g35450.2 68417.m05037 ankyrin repeat family protein / AFT protein (AFT) contains ankyrin repeats, Pfam:PF00023; identical to cDNA AFT protein (AFT) GI:3478699 Length = 342 Score = 32.7 bits (71), Expect = 0.29 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 1/88 (1%) Frame = +3 Query: 531 INALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL-DESWSYTAXXXXXXHSIRP 707 + L AAL+ G D D G+TALH+A G ++ ++L D S A + Sbjct: 231 VEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPLHY 290 Query: 708 GY*Y*NKKMLEVLINLAFSRFIMDVDFK 791 Y K+ + +L+ + + ++D K Sbjct: 291 AAGYGRKECVSLLLENGAAVTLQNLDEK 318 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILDES 659 +A + + G ++AVD+ T LHYA G E +L E+ Sbjct: 257 FACGYGELKCAQVLIDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLEN 306 >At4g35450.1 68417.m05036 ankyrin repeat family protein / AFT protein (AFT) contains ankyrin repeats, Pfam:PF00023; identical to cDNA AFT protein (AFT) GI:3478699 Length = 342 Score = 32.7 bits (71), Expect = 0.29 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 1/88 (1%) Frame = +3 Query: 531 INALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL-DESWSYTAXXXXXXHSIRP 707 + L AAL+ G D D G+TALH+A G ++ ++L D S A + Sbjct: 231 VEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPLHY 290 Query: 708 GY*Y*NKKMLEVLINLAFSRFIMDVDFK 791 Y K+ + +L+ + + ++D K Sbjct: 291 AAGYGRKECVSLLLENGAAVTLQNLDEK 318 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILDES 659 +A + + G ++AVD+ T LHYA G E +L E+ Sbjct: 257 FACGYGELKCAQVLIDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLEN 306 >At2g03430.1 68415.m00301 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 240 Score = 32.3 bits (70), Expect = 0.38 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +3 Query: 513 AADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 AA + L+ G ++A + G+TALHYA S G +E ++L Sbjct: 90 AASIGNAELVEVLLTRGADVNAKNNGGRTALHYAASKGRLEIAQLL 135 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 513 AADRNAINALSAALSGGCPIDAVDECGQTALHYAVSC 623 AA + + G IDA D+ GQTAL ++V C Sbjct: 156 AASVGKLEVCEFLIEEGAEIDATDKMGQTALMHSVIC 192 >At2g47450.1 68415.m05922 chloroplast signal recognition particle component (CAO) nearly identical to CAO [Arabidopsis thaliana] GI:4102582 Length = 373 Score = 31.5 bits (68), Expect = 0.66 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILDES 659 W A R A + L +DAVDE G+TAL + G + ++L E+ Sbjct: 133 WTAARKADEQALSQLLEDRDVDAVDENGRTALLFVAGLGSDKCVRLLAEA 182 >At5g12320.1 68418.m01448 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 144 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +3 Query: 513 AADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 AA N I+ L S G + + D G+TALH A + GH+ + L Sbjct: 18 AARYNDIDDLRTLASDGLSLHSRDSQGRTALHMAAANGHMTIVEYL 63 >At2g14250.1 68415.m01592 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 241 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 WAA N+++ + G +++ D QT LH+A G ++ +L Sbjct: 64 WAALNNSLHVAQYIIQHGGDVNSADNIQQTPLHWAAVKGSIDVADLL 110 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTK--ILDESWSYTA 674 WAA + +I+ L G I+AVD G A+H A G I+D + Y A Sbjct: 97 WAAVKGSIDVADLLLQHGARIEAVDVNGFRAVHVASQYGQTAFVNHIIVDYAADYNA 153 >At4g19150.1 68417.m02825 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 243 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 +A+ + + + LS G + ++ G T LHYA H E K L Sbjct: 89 FASQKGHLEVVRTLLSAGGSVKSITRKGLTPLHYAAQGSHFEIVKYL 135 >At3g03790.2 68416.m00389 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein similar to hect domain and RLD 2 GB:NP_004658 [Homo sapiens]; contains Pfam PF00415: Regulator of chromosome condensation (RCC1); contains Pfam PF00023: Ankyrin repeat; similar to rjs (GI:3414809) [Mus musculus]; similar to HERC2 (GI:4079809) [Homo sapiens] Length = 1081 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +3 Query: 498 HCTTWAADRNAINALSAALSGGCPIDAVD-ECGQTALHYAVSCGHVESTKIL-DESWSYT 671 H W RN I + L+ G DA D E G ++LH A+ GH+ +L D S+T Sbjct: 67 HIAVW---RNHIPIVRRLLAAGADPDARDGESGWSSLHRALHFGHLAVASVLIDSGASFT 123 >At3g03790.1 68416.m00388 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein similar to hect domain and RLD 2 GB:NP_004658 [Homo sapiens]; contains Pfam PF00415: Regulator of chromosome condensation (RCC1); contains Pfam PF00023: Ankyrin repeat; similar to rjs (GI:3414809) [Mus musculus]; similar to HERC2 (GI:4079809) [Homo sapiens] Length = 1078 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +3 Query: 498 HCTTWAADRNAINALSAALSGGCPIDAVD-ECGQTALHYAVSCGHVESTKIL-DESWSYT 671 H W RN I + L+ G DA D E G ++LH A+ GH+ +L D S+T Sbjct: 67 HIAVW---RNHIPIVRRLLAAGADPDARDGESGWSSLHRALHFGHLAVASVLIDSGASFT 123 >At3g01750.1 68416.m00112 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 664 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 570 IDAVDECGQTALHYAVSCGHVESTKIL 650 +DAVD G TALH A GH + +L Sbjct: 252 VDAVDNQGNTALHVAAYRGHADLVDVL 278 >At2g41520.2 68415.m05131 DNAJ heat shock N-terminal domain-containing protein contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1077 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/80 (23%), Positives = 35/80 (43%), Gaps = 2/80 (2%) Frame = +2 Query: 14 DSDFSDEDQSPLDSLFNKAADHLR--KITNKLDNGQLLELYGLFKQGTEGQCNTPKPGWL 187 DS F + D++P+ + N+++ R K+ K+ G+ G +G E Q PG+ Sbjct: 363 DSLFPEVDRNPVHARSNRSSKDKRSKKVKEKMKQGEPDRCNGQTAEGIEAQEKLNSPGYC 422 Query: 188 DGKGRRKWEAWKNLKDMPSE 247 ++ K P+E Sbjct: 423 SPMDYSPYQGDKTSNQFPTE 442 >At2g41520.1 68415.m05130 DNAJ heat shock N-terminal domain-containing protein contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1108 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/80 (23%), Positives = 35/80 (43%), Gaps = 2/80 (2%) Frame = +2 Query: 14 DSDFSDEDQSPLDSLFNKAADHLR--KITNKLDNGQLLELYGLFKQGTEGQCNTPKPGWL 187 DS F + D++P+ + N+++ R K+ K+ G+ G +G E Q PG+ Sbjct: 363 DSLFPEVDRNPVHARSNRSSKDKRSKKVKEKMKQGEPDRCNGQTAEGIEAQEKLNSPGYC 422 Query: 188 DGKGRRKWEAWKNLKDMPSE 247 ++ K P+E Sbjct: 423 SPMDYSPYQGDKTSNQFPTE 442 >At3g04710.1 68416.m00505 ankyrin repeat family protein contains Pfam profile: PF00023 ankyrin repeat Length = 456 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +3 Query: 513 AADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 AA + I + L G + E G TALH+A G +E K L Sbjct: 96 AARQGQIETVKYLLEQGADPNIASELGATALHHAAGTGEIELLKEL 141 >At2g04740.1 68415.m00484 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 578 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +3 Query: 531 INALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILDES 659 ++ L + G ++A D AL+YA GH++S ++L E+ Sbjct: 49 VDRLRYLVETGVNVNARDRWDSVALYYACLAGHIDSARLLLEN 91 >At3g59050.1 68416.m06582 amine oxidase family protein similar to polyamine oxidase (EC 1.5.3.11) precursor - Zea mays [SP|O64411]; contains Pfam profile PF01593 amine oxidase, flavin-containing Length = 488 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = +1 Query: 367 SPEPDLVHNELSLLDAAREDCGERVKELLIKKPELKYEKDEDGLTALPGLLTEM 528 S P VH S A EDC RV E + EL++E +E+ ++P L++ M Sbjct: 438 SSYPGSVHGAYSTGVLAAEDCRMRVLE---RYGELEHEMEEEAPASVPLLISRM 488 >At5g28810.1 68418.m03542 hypothetical protein Length = 560 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 17 SDFSDEDQSPLDSLFNKA-ADHLRKITNKLDN 109 S F + +PLD + NKA AD LR + LDN Sbjct: 524 SSFEETFSNPLDQMANKATADALRALQEGLDN 555 >At5g14230.1 68418.m01663 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 591 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +3 Query: 513 AADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 AA ++ + + GC I++ ++ G TAL ++ H E K+L Sbjct: 188 AARDGSVEIIQQLVGFGCDINSKNDVGNTALLISIKHKHPECVKVL 233 >At4g39210.1 68417.m05551 glucose-1-phosphate adenylyltransferase large subunit 3 (APL3) / ADP-glucose pyrophosphorylase identical to SP|P55231 Length = 521 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 Query: 685 EGNTPLDLATDTEIRKC 735 EGN P+ + DT+IRKC Sbjct: 454 EGNVPIGIGRDTKIRKC 470 >At5g07270.1 68418.m00829 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 513 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 510 WAADRNAINALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKIL 650 +AA + + L G +++ + CGQTAL A GH E + L Sbjct: 51 FAAAKGHNEIVGLLLENGADVNSRNYCGQTALMQACRYGHWEVVQTL 97 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 38 QSPLDSLFNKAADHLRKITNKLDNGQLLELYGLFKQGTEGQCNTPKPGW 184 +SP SL +++ + ++ G L+ + GL Q T N P P W Sbjct: 34 KSPASSLLSRSRPLVAAFSSVFRGG-LVSVKGLSTQATSSSLNDPNPNW 81 >At3g12360.1 68416.m01541 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 590 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +1 Query: 388 HNELSLLDAAREDCGERVKELLIKKPELKYEKDEDGLTAL 507 +N+ +L AAR+ E +K LL K P+L D+ G TAL Sbjct: 231 NNKNALHLAARQGHVEVIKALLSKDPQLARRIDKKGQTAL 270 >At5g54070.1 68418.m06731 heat shock transcription factor family protein contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 331 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/31 (32%), Positives = 21/31 (67%) Frame = +1 Query: 310 QKTNIDTKETWVAVSSMRYSPEPDLVHNELS 402 QK +D + ++A+++ ++PEPD++ N S Sbjct: 273 QKNLLDVEREFMAMAATEHNPEPDILVNNQS 303 >At5g49780.1 68418.m06165 leucine-rich repeat transmembrane protein kinase, putative Length = 1006 Score = 27.9 bits (59), Expect = 8.2 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = -1 Query: 358 LMKQLPMFPWYQYLSFEVYLTSQDHIFSTKQYISPSLFTGHIFKILPGLPFP 203 L+ L +FP+ Q E + S FST+ Y P+ F +IFK FP Sbjct: 552 LLIDLSLFPYKQDRFNETGMDSVISRFSTQTYKPPNTFGPYIFKANKYNKFP 603 >At2g43030.1 68415.m05340 ribosomal protein L3 family protein contains Pfam profile PF00297: ribosomal protein L3 Length = 271 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 144 KVLKVNATLQSLGG*MVKDVGNGRPGRILKICPVKRLG 257 K++KV+ L + M+K G+PG +L+I P K +G Sbjct: 231 KIVKVDKELNVV---MIKGALPGKPGNLLRITPAKIVG 265 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,989,066 Number of Sequences: 28952 Number of extensions: 357841 Number of successful extensions: 1098 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1097 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1785055200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -