BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00659 (734 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 24 1.1 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 7.8 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 24.2 bits (50), Expect = 1.1 Identities = 14/42 (33%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +2 Query: 395 NLKNILAFGTPSLYSLSVWEISYSS-VRAIFVKRDTKFFFTY 517 NLK ++A G + S++ +++ SS +RA+F+K +F T+ Sbjct: 91 NLKTLVAIGGWNEGSVNYSKMAASSSLRAVFIKSVVEFVKTW 132 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 538 IFDLLST*YCIVFRLQIIYFFKLNFV 615 IF + YC++ L IY+F F+ Sbjct: 221 IFTIHLLFYCVLIILLCIYYFYYAFI 246 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,005 Number of Sequences: 336 Number of extensions: 3233 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -