BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00659 (734 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK098748-1|BAC05402.1| 130|Homo sapiens protein ( Homo sapiens ... 30 9.9 AF492460-1|AAN64030.1| 1322|Homo sapiens WD repeat 17 protein. 30 9.9 >AK098748-1|BAC05402.1| 130|Homo sapiens protein ( Homo sapiens cDNA FLJ25882 fis, clone CBR02655. ). Length = 130 Score = 29.9 bits (64), Expect = 9.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 316 ILFVYCQTFALDVCGQIENRLKYCLSLLIFFYSV 215 +L CQ + DVC +R YC +L I+ Y + Sbjct: 9 LLAAGCQPWNKDVCAASGDRFAYCATLAIYIYQL 42 >AF492460-1|AAN64030.1| 1322|Homo sapiens WD repeat 17 protein. Length = 1322 Score = 29.9 bits (64), Expect = 9.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 316 ILFVYCQTFALDVCGQIENRLKYCLSLLIFFYSV 215 +L CQ + DVC +R YC +L I+ Y + Sbjct: 33 LLAAGCQPWNKDVCAASGDRFAYCATLAIYIYQL 66 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,259,599 Number of Sequences: 237096 Number of extensions: 1460816 Number of successful extensions: 5581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5580 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8735159784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -