BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00654 (758 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC732.02c |||fructose-2,6-bisphosphate 2-phosphatase activity ... 26 6.7 SPBP4G3.03 |||PI31 proteasome regulator related|Schizosaccharomy... 25 8.9 >SPAC732.02c |||fructose-2,6-bisphosphate 2-phosphatase activity |Schizosaccharomyces pombe|chr 1|||Manual Length = 408 Score = 25.8 bits (54), Expect = 6.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 535 HEVKILETEKNHVVYRGGNTY 597 HE ++ +K H YRGG +Y Sbjct: 305 HEAELRNNDKFHYRYRGGESY 325 >SPBP4G3.03 |||PI31 proteasome regulator related|Schizosaccharomyces pombe|chr 2|||Manual Length = 241 Score = 25.4 bits (53), Expect = 8.9 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 347 QTGMVMNITDLKKYIKTAILEPLDHKNLDND 439 Q G + DL +I + +HK LDND Sbjct: 89 QQGQIETKPDLTLFINELLTTKKEHKKLDND 119 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,028,576 Number of Sequences: 5004 Number of extensions: 62102 Number of successful extensions: 162 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -