BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00654 (758 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0120 + 16859617-16860504,16860970-16861146,16861242-168614... 29 4.0 03_02_0168 + 6094658-6096220,6096335-6096608,6096671-6096821,609... 29 4.0 >06_03_0120 + 16859617-16860504,16860970-16861146,16861242-16861435, 16861952-16862048 Length = 451 Score = 29.1 bits (62), Expect = 4.0 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 5/67 (7%) Frame = +3 Query: 78 ISIKKQNSI*CVKFLILTVFEFSIELLNYTMSSLPIVSIIRRETF-SSAHRLH-SPF--- 242 IS+K Q + VK +I+T+ +F I + +P SII T+ + H L P+ Sbjct: 382 ISVKCQKEVMWVKKIIMTLTQFGIPHQRICVKEIPRSSIISEMTYLQTEHNLRMKPYKCV 441 Query: 243 LSDERTK 263 LSD + K Sbjct: 442 LSDLKAK 448 >03_02_0168 + 6094658-6096220,6096335-6096608,6096671-6096821, 6097052-6097262,6097344-6097550,6097982-6098350 Length = 924 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 424 LMVEWFQDGCFYVFLEVSYIHHHTSLR 344 L+V W+Q G FY F + HH T R Sbjct: 632 LLVRWYQVGAFYPFFR-GHAHHDTKRR 657 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,498,616 Number of Sequences: 37544 Number of extensions: 328473 Number of successful extensions: 644 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -