BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00654 (758 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 27 0.25 AJ876408-1|CAI45289.1| 52|Apis mellifera putative diuretic hor... 22 7.2 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 26.6 bits (56), Expect = 0.25 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -3 Query: 519 FHYS*SWSQTYIATFSVVLAIVLKYGTSLSKFLWSS 412 ++YS W Q + + +I+L GT+L + +W + Sbjct: 261 YNYSMYWGQGHAILKGLKTSIILMNGTTLPQIMWGT 296 >AJ876408-1|CAI45289.1| 52|Apis mellifera putative diuretic hormone-I protein. Length = 52 Score = 21.8 bits (44), Expect = 7.2 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = -2 Query: 220 AELKVSRRIIDTIGK 176 A++ +RR+++TIGK Sbjct: 38 AQIDANRRLLETIGK 52 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,279 Number of Sequences: 438 Number of extensions: 4562 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -