Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00654
         (758 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g42250.1 68415.m05230 cytochrome P450 family protein similar ...    29   3.4  

>At2g42250.1 68415.m05230 cytochrome P450 family protein similar to
           cytochrome P450 93A1 (SP:Q42798) [Glycine max]
          Length = 514

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 2/68 (2%)
 Frame = +1

Query: 379 QEIHKNSHP--GTTRP*EFR**CSILQNYGKYYRKCRNICLGPTSRIMEKPQLLHEVKIL 552
           QE++ +S P  G+    ++R    +L  YG Y+R  + +C+   ++++  PQL     I 
Sbjct: 101 QELNFSSRPEFGSAEYFKYRGSRFVLAQYGDYWRFMKKLCM---TKLLAVPQLEKFADIR 157

Query: 553 ETEKNHVV 576
           E EK  +V
Sbjct: 158 EEEKLKLV 165


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,144,458
Number of Sequences: 28952
Number of extensions: 299122
Number of successful extensions: 652
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 643
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 652
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1692519896
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)