BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00647 (731 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 23 2.5 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 4.4 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 22 5.9 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 21 7.8 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 23.0 bits (47), Expect = 2.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 631 IIWSSNLISWPSM*SLLWRNLCLLYSW 551 IIWSSNL P + L + ++ SW Sbjct: 453 IIWSSNLSKRPYIYKYLDKKNVVVQSW 479 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +1 Query: 178 KDEGQDEHNIRKQEEVLQESLMMVPDVK 261 K +G+D+ + ++E VL ++ PD + Sbjct: 77 KIDGEDDSGLTEEEVVLSNAIAEGPDAE 104 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +3 Query: 525 KSRHQNKCHQEYNKHKFRHSKDYIDGHEIKFELQIICHLSHQHTSRPHPH 674 + + + H+ + +H H ++ E KF L H H S+ +PH Sbjct: 74 EQKQKEDVHKVF-QHLMIHRPNWWHELETKFNPHHEIKLQHLHQSKFNPH 122 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +3 Query: 93 DGRRETDCQGKSSLREGSRATEE 161 +GRR DC SS+ + E+ Sbjct: 23 EGRRVVDCDDVSSVSQSEAGDED 45 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,162 Number of Sequences: 336 Number of extensions: 2586 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -