BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00647 (731 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1220 + 35021495-35021647,35022819-35022905,35022988-35023086 45 5e-05 04_04_0352 + 24619621-24619757,24620102-24620411,24621022-246214... 33 0.31 03_02_0894 + 12226006-12226484,12226601-12226709 32 0.54 05_01_0024 - 164618-165139,166884-166949,167046-167216,167321-16... 31 1.2 08_01_0400 - 3538570-3540363,3540895-3541639,3543688-3544007 29 3.8 08_01_0698 + 6162127-6162160,6162317-6162512,6162654-6162699 28 6.6 07_03_0940 + 22762176-22762345,22763207-22763252 28 6.6 >02_05_1220 + 35021495-35021647,35022819-35022905,35022988-35023086 Length = 112 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/61 (36%), Positives = 34/61 (55%) Frame = +1 Query: 73 IRQIKIKTGVVKRIXXXXXXXXXXXXLQKNRIQRIKDEGQDEHNIRKQEEVLQESLMMVP 252 +R +KIKT KRI + + +K++G D +++++QE VL ES MMVP Sbjct: 4 LRNLKIKTSTCKRIVKELRSYEKEVEKEAAKTADMKEKGADPYDLKQQENVLAESRMMVP 63 Query: 253 D 255 D Sbjct: 64 D 64 >04_04_0352 + 24619621-24619757,24620102-24620411,24621022-24621429, 24621773-24622357 Length = 479 Score = 32.7 bits (71), Expect = 0.31 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +3 Query: 516 PQHKSRHQNKCHQEYNKHK-FRHSKDYIDGHEIKFELQIICHLSHQHTSRP 665 P H+ R +C Y HK F + G + + LQI C + HTSRP Sbjct: 33 PPHELRAPRRCSPSYTSHKVFHRDVGFFSGWQ-SYNLQIYCCI---HTSRP 79 >03_02_0894 + 12226006-12226484,12226601-12226709 Length = 195 Score = 31.9 bits (69), Expect = 0.54 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +2 Query: 572 VSPQQGLHRRPRDQIRAPNYMPPQSPAYFTATPSLTPMLLLTHTHSHA 715 + P L RR R +RAP+ Q+P + PSLT + + H HS A Sbjct: 26 IEPCGLLQRRSRWAVRAPS-TAQQAPFTYPQPPSLTKKICIHHLHSPA 72 >05_01_0024 - 164618-165139,166884-166949,167046-167216,167321-167422, 167538-167600,167679-167825,168234-168359,168742-168921, 169183-169322,169688-169861,170096-170123 Length = 572 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +2 Query: 557 IQQAQVSPQQGLHRRPRDQIRAPNYMPPQSPAYFTATPSLTP 682 ++Q Q PQ P + +AP P Q P Y TP+ P Sbjct: 428 VKQHQQEPQDNSRELPASEPKAPPGWPLQPPMYLPVTPAPPP 469 >08_01_0400 - 3538570-3540363,3540895-3541639,3543688-3544007 Length = 952 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 258 QRRLIKAYTDLKTTLE-TEQDLKEHEEYITAEQVLKDAEPQ 377 +RR+ K Y D K + E D+K+ + A +KD EP+ Sbjct: 284 RRRVRKEYDDFKARINGLEHDIKQRSDSYNAAAGVKDGEPR 324 >08_01_0698 + 6162127-6162160,6162317-6162512,6162654-6162699 Length = 91 Score = 28.3 bits (60), Expect = 6.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 585 CCGETCACCILGDICF 538 CC C CC+L D+CF Sbjct: 77 CCAALCCCCLL-DMCF 91 >07_03_0940 + 22762176-22762345,22763207-22763252 Length = 71 Score = 28.3 bits (60), Expect = 6.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 585 CCGETCACCILGDICF 538 CC C CC+L D+CF Sbjct: 57 CCAALCCCCLL-DMCF 71 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,153,792 Number of Sequences: 37544 Number of extensions: 251642 Number of successful extensions: 902 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 897 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -