BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00647 (731 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30410.1 68415.m03704 tubulin folding cofactor A (KIESEL) ide... 47 1e-05 At2g04620.1 68415.m00470 cation efflux family protein potential ... 33 0.20 At5g56930.1 68418.m07107 zinc finger (CCCH-type) family protein ... 29 2.4 At1g70280.2 68414.m08086 NHL repeat-containing protein contains ... 29 2.4 At1g70280.1 68414.m08085 NHL repeat-containing protein contains ... 29 2.4 At1g15730.1 68414.m01887 PRLI-interacting factor L, putative str... 28 7.3 >At2g30410.1 68415.m03704 tubulin folding cofactor A (KIESEL) identical to cDNA tubulin folding cofactor A, GI:20514256, SP|O04350 Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin cofactor A homolog) {Arabidopsis thaliana} Length = 113 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/61 (37%), Positives = 34/61 (55%) Frame = +1 Query: 73 IRQIKIKTGVVKRIXXXXXXXXXXXXLQKNRIQRIKDEGQDEHNIRKQEEVLQESLMMVP 252 IR +KIKT KRI + + +KD+G D +++++QE VL ES MM+P Sbjct: 4 IRNLKIKTSTCKRIVKELHSYEKEVEREAAKTADMKDKGADPYDLKQQENVLGESRMMIP 63 Query: 253 D 255 D Sbjct: 64 D 64 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 33.1 bits (72), Expect = 0.20 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 2/73 (2%) Frame = +3 Query: 519 QHKSRHQNKCHQEYNKHKFRHSKDYID-GHEIKFELQIICHLSHQHTSRPHPH*H-QCYY 692 +H+ HQ H + +KH+ H D+ H K E C+ +H H + H H H +C + Sbjct: 578 KHEEHHQ---HSDSHKHEEHHEHDHHHHSHSHKHEE---CNHNHDHEHQSHSHNHEECNH 631 Query: 693 SLTHTHTRTESDK 731 + H H+ + +K Sbjct: 632 NHDH-HSDHQPEK 643 Score = 29.9 bits (64), Expect = 1.8 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 3/66 (4%) Frame = +3 Query: 522 HKSR-HQNKCHQEYN-KHKFRHSKDYIDGHEIKFELQIICHLSHQHTSRPHPH*H-QCYY 692 H+S H+N+ H +++ HK + D H K E H H H H H H +C + Sbjct: 560 HQSHSHKNEEHHQHSDSHKHEEHHQHSDSH--KHEE----HHEHDHHHHSHSHKHEECNH 613 Query: 693 SLTHTH 710 + H H Sbjct: 614 NHDHEH 619 >At5g56930.1 68418.m07107 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 675 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -3 Query: 597 RCSPCCGETCACCILGDIC-FDDD 529 +CSPCC C+ GD C FD D Sbjct: 381 KCSPCCYFATQSCMKGDDCPFDHD 404 >At1g70280.2 68414.m08086 NHL repeat-containing protein contains Pfam profile PF01436: NHL repeat Length = 509 Score = 29.5 bits (63), Expect = 2.4 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 7/84 (8%) Frame = +3 Query: 501 PPPRQPQHKSRHQNKCHQEYNKHKF---RHSKDYIDGHEIKF----ELQIICHLSHQHTS 659 PPP +P++ + + + K R S+ + + +F + Q H HQH Sbjct: 370 PPPVEPRNPTPRKTYAFMSKDAEKMQQLRQSRAFYSSWDAEFPNQQQQQQKQHQKHQHQQ 429 Query: 660 RPHPH*HQCYYSLTHTHTRTESDK 731 + + Y S+ HT+ +S+K Sbjct: 430 QQQQQHRRHYSSIPHTYYEQDSEK 453 >At1g70280.1 68414.m08085 NHL repeat-containing protein contains Pfam profile PF01436: NHL repeat Length = 447 Score = 29.5 bits (63), Expect = 2.4 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 7/84 (8%) Frame = +3 Query: 501 PPPRQPQHKSRHQNKCHQEYNKHKF---RHSKDYIDGHEIKF----ELQIICHLSHQHTS 659 PPP +P++ + + + K R S+ + + +F + Q H HQH Sbjct: 308 PPPVEPRNPTPRKTYAFMSKDAEKMQQLRQSRAFYSSWDAEFPNQQQQQQKQHQKHQHQQ 367 Query: 660 RPHPH*HQCYYSLTHTHTRTESDK 731 + + Y S+ HT+ +S+K Sbjct: 368 QQQQQHRRHYSSIPHTYYEQDSEK 391 >At1g15730.1 68414.m01887 PRLI-interacting factor L, putative strong similarity to PRLI-interacting factor L GI:11139268 from [Arabidopsis thaliana]; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 448 Score = 27.9 bits (59), Expect = 7.3 Identities = 8/33 (24%), Positives = 16/33 (48%) Frame = +3 Query: 510 RQPQHKSRHQNKCHQEYNKHKFRHSKDYIDGHE 608 R+ H + CH +N+H+ H ++ H+ Sbjct: 314 REGHDDHHHGHDCHDHHNEHEHEHEHEHHHSHD 346 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,349,366 Number of Sequences: 28952 Number of extensions: 207180 Number of successful extensions: 773 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 766 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -