BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00646 (615 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB065676-1|BAC05901.1| 311|Homo sapiens seven transmembrane hel... 34 0.46 AL160283-2|CAH72417.1| 309|Homo sapiens olfactory receptor, fam... 30 7.5 AB065636-1|BAC05862.1| 309|Homo sapiens seven transmembrane hel... 30 7.5 >AB065676-1|BAC05901.1| 311|Homo sapiens seven transmembrane helix receptor protein. Length = 311 Score = 33.9 bits (74), Expect = 0.46 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = -2 Query: 203 FIIYNKNITGNFVSTKIEWVVLDLHSLTPFHIFLLVSQIILLEFCY 66 FI Y+ + GN + + W+ L LH TP + FL S + LL+ C+ Sbjct: 32 FIFYSLTLFGNTIIIALSWLDLRLH--TPMYFFL--SHLSLLDLCF 73 >AL160283-2|CAH72417.1| 309|Homo sapiens olfactory receptor, family 10, subfamily X, member 1 protein. Length = 309 Score = 29.9 bits (64), Expect = 7.5 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -2 Query: 203 FIIYNKNITGNFVSTKIEWVVLDLHSLTPFHIFLLVSQIILLEFCY 66 F +Y + GN + + WV LH TP ++FL S + E CY Sbjct: 31 FCLYLLTLAGNLIIMGLTWVDRSLH--TPMYLFL--SALSFSETCY 72 >AB065636-1|BAC05862.1| 309|Homo sapiens seven transmembrane helix receptor protein. Length = 309 Score = 29.9 bits (64), Expect = 7.5 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -2 Query: 203 FIIYNKNITGNFVSTKIEWVVLDLHSLTPFHIFLLVSQIILLEFCY 66 F +Y + GN + + WV LH TP ++FL S + E CY Sbjct: 31 FCLYLLTLAGNLIIMGLTWVDRSLH--TPMYLFL--SALSFSETCY 72 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,492,637 Number of Sequences: 237096 Number of extensions: 1022685 Number of successful extensions: 1347 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1347 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6579110070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -