BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00645 (553 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43079| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) 29 3.3 >SB_43079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 508 Score = 44.8 bits (101), Expect = 5e-05 Identities = 21/39 (53%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +1 Query: 394 KIRLEMHMEQVFLDTVD-AYVWIYDPKPWYYWVCGILVV 507 K++LE+H EQ+F D D AYVWIYDP + GI+VV Sbjct: 346 KVKLELHEEQIFFDADDEAYVWIYDPVHPKTFAMGIVVV 384 >SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) Length = 264 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = -1 Query: 544 RPEWEHATVIVPRRPESHRPSS--TKASGRRSRRKHRPY--PKKLAPY 413 RP+ H + PR E HRP R + +HRP PK L P+ Sbjct: 181 RPQESHRPLEPPRPQEPHRPQEPHRPLEPPRPQEQHRPQEPPKTLEPH 228 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,795,788 Number of Sequences: 59808 Number of extensions: 289588 Number of successful extensions: 1075 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1071 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -