BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00644 (746 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 26 0.28 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 25 0.64 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 23 2.6 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 2.6 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 22 6.0 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 6.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 6.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 6.0 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 7.9 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 26.2 bits (55), Expect = 0.28 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = -1 Query: 428 VLTVVMKNWEPLVSAPALAMERTPGPVCLRVKFSSSNLLP*MDFPPVPLWLVKSP 264 VL + M +EP P++ PGP F +N LP PP+PL + +P Sbjct: 143 VLNLTMPKYEP---NPSII---DPGPALPPAGFLCNNYLPLPQVPPLPLPPIFAP 191 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 25.0 bits (52), Expect = 0.64 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +2 Query: 296 ESPSTAISLKTR---ISPLSTLDLASSPWLMPV 385 ESP A L R I +ST+DL SS W +P+ Sbjct: 373 ESPPAADELLRRFHEIRYMSTIDLRSSYWQIPL 405 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 167 TCENFRALCTGEK 205 T ++FR LCTG K Sbjct: 408 TLDDFRGLCTGNK 420 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.0 bits (47), Expect = 2.6 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -1 Query: 428 VLTVVMKNWEPLVSAPALAMERTPGPVCLRVKFSSSNLLP*MDFPPVPL 282 VL + M +EP P++ PGP F +N P PP+PL Sbjct: 143 VLNLTMPKYEP---NPSII---DPGPALPPTGFLCNNYPPLPQVPPLPL 185 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 199 ASAQGTEVFTRLGSDVTSQLNNNFSQWGIVNSDVE-EY 89 A G ++L + + S + FSQWG D++ EY Sbjct: 110 AILNGIVASSKLRASLISSCLSFFSQWGYDGIDIDWEY 147 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -3 Query: 735 KCITQFATSIAIFY 694 KC+ F T++ IFY Sbjct: 63 KCLAFFCTALVIFY 76 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -3 Query: 735 KCITQFATSIAIFY 694 KC+ F T++ IFY Sbjct: 296 KCLAFFCTALVIFY 309 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -3 Query: 735 KCITQFATSIAIFY 694 KC+ F T++ IFY Sbjct: 296 KCLAFFCTALVIFY 309 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -2 Query: 523 FPDWLQRSQSA*QLPCLQQHSQRQHVC 443 + DW + Q C+Q +Q Q +C Sbjct: 99 YVDWCSTNPCENQATCVQNKNQYQCLC 125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,666 Number of Sequences: 336 Number of extensions: 4459 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -