BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00642 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 123 1e-28 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 120 7e-28 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 89 3e-18 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 89 3e-18 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 79 4e-15 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 74 1e-13 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 69 2e-12 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 64 6e-11 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 60 2e-09 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 59 2e-09 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 54 7e-08 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 50 2e-06 SB_3229| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 49 3e-06 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 48 4e-06 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 46 2e-05 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 42 3e-04 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 42 5e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 38 0.005 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 35 0.057 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 31 0.53 SB_24825| Best HMM Match : 7tm_1 (HMM E-Value=4.5e-29) 31 0.71 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 30 1.2 SB_5993| Best HMM Match : EGF_2 (HMM E-Value=9e-14) 30 1.6 SB_48110| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) 29 2.9 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_55750| Best HMM Match : PWWP (HMM E-Value=6.4e-07) 29 3.8 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_25304| Best HMM Match : HDV_ag (HMM E-Value=0.55) 29 3.8 SB_33720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_44173| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_30467| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 123 bits (296), Expect = 1e-28 Identities = 60/73 (82%), Positives = 67/73 (91%) Frame = +1 Query: 289 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTR 468 GFEKPSAIQQRAI P ++GRDVIAQAQSGTGKTATFSIS+LQ IDT +RE QAL+L+PTR Sbjct: 16 GFEKPSAIQQRAIKPILKGRDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSPTR 75 Query: 469 ELAQQIQKVVIAL 507 ELA QIQKVV+AL Sbjct: 76 ELANQIQKVVLAL 88 Score = 48.4 bits (110), Expect = 4e-06 Identities = 17/29 (58%), Positives = 25/29 (86%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 D+++ +CHACIGGTN+ EDIR+L+ G H+ Sbjct: 90 DYMSVQCHACIGGTNIGEDIRKLDYGQHI 118 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 120 bits (290), Expect = 7e-28 Identities = 72/112 (64%), Positives = 79/112 (70%), Gaps = 28/112 (25%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQ----------------------GRDVIAQAQ 369 KE LLRGIYAYGFEKPSAIQQRAI PC Q RDVIAQAQ Sbjct: 71 KEALLRGIYAYGFEKPSAIQQRAIRPCCQEFSPSHVCYNQLNLTKNHYVLSARDVIAQAQ 130 Query: 370 SGTGKTATFSISILQQIDTSIRE------CQALILAPTRELAQQIQKVVIAL 507 SGTGKTATF+ISILQ+IDT+ ++ CQAL+LAPTRELAQQIQKVV+AL Sbjct: 131 SGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLAL 182 Score = 52.4 bits (120), Expect = 3e-07 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 D+++ KCHACIGGTNVRED +LE GVHV Sbjct: 184 DYMHVKCHACIGGTNVREDRMKLEEGVHV 212 Score = 32.3 bits (70), Expect = 0.31 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 200 GTLDTDWDQVVETFDDMNPKK 262 G ++WD+VVE+FDDMN K+ Sbjct: 52 GKRQSNWDEVVESFDDMNLKE 72 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 88.6 bits (210), Expect = 3e-18 Identities = 41/84 (48%), Positives = 60/84 (71%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K ELL GI+ GF+KPS IQ+ +I + GRD++A+A++GTGKTA + + +L++ DT+ Sbjct: 55 KRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLERTDTTKN 114 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 QAL+L PTRELA Q ++ I L Sbjct: 115 CIQALVLVPTRELALQTSQICIEL 138 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 88.6 bits (210), Expect = 3e-18 Identities = 41/84 (48%), Positives = 60/84 (71%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K ELL GI+ GF+KPS IQ+ +I + GRD++A+A++GTGKTA + + +L++ DT+ Sbjct: 55 KRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLERTDTTKN 114 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 QAL+L PTRELA Q ++ I L Sbjct: 115 CIQALVLVPTRELALQTSQICIEL 138 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 78.6 bits (185), Expect = 4e-15 Identities = 41/81 (50%), Positives = 54/81 (66%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 LLRG+ GFEKPS IQ +AI G D+IAQA+SGTGKT FS+ L+ + T Q Sbjct: 24 LLRGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGKTCVFSVIALENVITESNCIQ 83 Query: 445 ALILAPTRELAQQIQKVVIAL 507 +IL PTRE+A Q++ V+ A+ Sbjct: 84 IIILTPTREIAVQVKDVICAI 104 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/79 (48%), Positives = 48/79 (60%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K ELLR I GFE PS +Q I I G D+I QA+SG GKTA F ++ LQQ++ Sbjct: 55 KPELLRAIVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGKTAVFVLATLQQLEPVDG 114 Query: 436 ECQALILAPTRELAQQIQK 492 + L++ TRELA QI K Sbjct: 115 QVSVLVMCHTRELAFQIHK 133 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/79 (48%), Positives = 48/79 (60%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K ELLR I GFE PS +Q I I G D+I QA+SG GKTA F ++ LQQ++ Sbjct: 55 KPELLRAIVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGKTAVFVLATLQQLEPVDG 114 Query: 436 ECQALILAPTRELAQQIQK 492 + L++ TRELA QI K Sbjct: 115 QVSVLVMCHTRELAFQIHK 133 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 69.3 bits (162), Expect = 2e-12 Identities = 38/83 (45%), Positives = 53/83 (63%), Gaps = 2/83 (2%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDV--IAQAQSGTGKTATFSISILQQIDTSIRE 438 L RG+Y GF KPS IQ+ A+ + V IAQ+QSGTGKTA F +++L ++D + Sbjct: 114 LRRGVYDMGFNKPSKIQETALPMLLADPPVNMIAQSQSGTGKTAAFVLTMLSRVDATKPY 173 Query: 439 CQALILAPTRELAQQIQKVVIAL 507 Q + L+PT ELA+Q KV A+ Sbjct: 174 PQVICLSPTYELARQTGKVAEAM 196 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 64.5 bits (150), Expect = 6e-11 Identities = 32/68 (47%), Positives = 45/68 (66%) Frame = +1 Query: 283 AYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAP 462 A G +KP+ IQ + P +QGRD I A++G+GKTA F++ ILQ++ A++L P Sbjct: 24 AMGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGKTAAFALPILQKLCDDPYGIFAVVLTP 83 Query: 463 TRELAQQI 486 TRELA QI Sbjct: 84 TRELAFQI 91 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 60.1 bits (139), Expect = 1e-09 Identities = 32/81 (39%), Positives = 52/81 (64%), Gaps = 5/81 (6%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISIL-----QQID 423 E+L+ I G+ +P+ +Q+ A+ + GRD++A AQ+G+GKTA + + +L Q ++ Sbjct: 488 EQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGSGKTAAYMLPVLTSLIKQGLN 547 Query: 424 TSIRECQALILAPTRELAQQI 486 R AL +APTRELA+QI Sbjct: 548 APPRSPLALCVAPTRELAKQI 568 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/90 (37%), Positives = 58/90 (64%), Gaps = 9/90 (10%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISIL--------- 411 + +L + G++ P+ IQ++AI +Q RD+I A++G+GKTA F+I +L Sbjct: 110 DSILEIVDKLGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFAIPLLVWIMGLPKI 169 Query: 412 QQIDTSIRECQALILAPTRELAQQIQKVVI 501 ++ + + + ALILAPTRELAQQI++ ++ Sbjct: 170 ERDNDADQGPYALILAPTRELAQQIEEEIL 199 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 59.3 bits (137), Expect = 2e-09 Identities = 33/84 (39%), Positives = 52/84 (61%), Gaps = 4/84 (4%) Frame = +1 Query: 268 LRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQ----QIDTSIR 435 L G+ GF P+ IQ++ I + GRDV+ A++G+GKT F I I++ Q TS+ Sbjct: 62 LDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTLAFLIPIIETLWRQKWTSMD 121 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 AL+++PTRELA Q +V++ + Sbjct: 122 GLGALVISPTRELAYQTFEVLVKI 145 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 54.8 bits (126), Expect = 5e-08 Identities = 33/85 (38%), Positives = 50/85 (58%), Gaps = 9/85 (10%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI------ 420 E L + ++KP+ +Q+ +I I GRDV+A AQ+G+GKTA F + ++ + Sbjct: 720 EAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGKTAAFLLPVMTSMMNAGLT 779 Query: 421 DTSIREC---QALILAPTRELAQQI 486 +S E QA+ +APTRELA QI Sbjct: 780 SSSFSETQTPQAMCIAPTRELANQI 804 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 54.4 bits (125), Expect = 7e-08 Identities = 30/74 (40%), Positives = 42/74 (56%), Gaps = 3/74 (4%) Frame = +1 Query: 271 RGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI---DTSIREC 441 R + GF P+ IQ I + G+DV A A +GTGKTA F + IL+++ T Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTAAFMLPILERLLYRPTQSPAI 82 Query: 442 QALILAPTRELAQQ 483 + L++ PTRELA Q Sbjct: 83 RVLVITPTRELAIQ 96 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 53.6 bits (123), Expect = 1e-07 Identities = 26/56 (46%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = +1 Query: 337 IQGRDVIAQAQSGTGKTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVV 498 + G+DV+A A++G+GKTA F I + +++ T + +ALIL+PTRELA Q QK + Sbjct: 316 MDGKDVVAMARTGSGKTAAFLIPMFEKLQTHTAKVGIRALILSPTRELALQTQKFI 371 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 52.8 bits (121), Expect = 2e-07 Identities = 28/79 (35%), Positives = 48/79 (60%), Gaps = 4/79 (5%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATF---SISILQQIDTS 429 E+ L+GI GF + IQ ++I P ++GRD++ A++G+GKT F + +L ++ Sbjct: 581 EKTLQGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVVELLYKLQFK 640 Query: 430 IRE-CQALILAPTRELAQQ 483 R +I++PTREL+ Q Sbjct: 641 TRNGTGVIIISPTRELSLQ 659 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 52.0 bits (119), Expect = 4e-07 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 5/81 (6%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATF----SISILQQIDT 426 E+++ I + +P+ IQ +A+ + GRD+I A++G+GKTA F + I+ Q + Sbjct: 526 EQMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPEL 585 Query: 427 SIRECQ-ALILAPTRELAQQI 486 + + LI APTREL QQI Sbjct: 586 QVGDGPIVLICAPTRELCQQI 606 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 51.2 bits (117), Expect = 6e-07 Identities = 37/96 (38%), Positives = 52/96 (54%), Gaps = 20/96 (20%) Frame = +1 Query: 262 ELLRGIYAYGFEKPSAIQQRAIMPCI-QGRDVIAQAQSGTGKTATFSISILQQIDT---- 426 ++LR + GF KP+ IQ +I P + RD+I A++G+GKT F I I+Q I+ Sbjct: 140 DILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAETGSGKTLAFGIPIIQHIEAYKKR 199 Query: 427 ----------SIRECQ-----ALILAPTRELAQQIQ 489 S E Q ALI+APTRELA Q++ Sbjct: 200 KAEQSPSDKESDLESQGYPLLALIMAPTRELALQVK 235 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 49.6 bits (113), Expect = 2e-06 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 5/70 (7%) Frame = +1 Query: 292 FEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ-----ALIL 456 F+ P+ IQ +++ + GRD+I A++G+GKT +S+ + + T ALIL Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALIL 151 Query: 457 APTRELAQQI 486 PTREL QQ+ Sbjct: 152 TPTRELMQQV 161 >SB_3229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 49.2 bits (112), Expect = 2e-06 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = +3 Query: 516 LNAKCHACIGGTNVREDIRQLETGVHV 596 ++ KCHACIGGTNVRED +LE GVHV Sbjct: 1 MHVKCHACIGGTNVREDRMKLEEGVHV 27 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 48.8 bits (111), Expect = 3e-06 Identities = 26/54 (48%), Positives = 36/54 (66%) Frame = +1 Query: 346 RDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIAL 507 +DVI A++G+GKT F++ ILQ + + + ALIL PTRELA QI + AL Sbjct: 2 KDVIGLAETGSGKTGAFALPILQALLDNPQRLFALILTPTRELAFQISEQCEAL 55 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 48.4 bits (110), Expect = 4e-06 Identities = 17/29 (58%), Positives = 25/29 (86%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 D+++ +CHACIGGTN+ EDIR+L+ G H+ Sbjct: 28 DYMSVQCHACIGGTNIGEDIRKLDYGQHI 56 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = +1 Query: 430 IRECQALILAPTRELAQQIQKVVIAL 507 +RE QAL+L+PTRELA QIQKVV+AL Sbjct: 1 LREPQALVLSPTRELANQIQKVVLAL 26 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 48.0 bits (109), Expect = 6e-06 Identities = 26/55 (47%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQG-RDVIAQAQSGTGKTATFSISILQQI 420 E LL + G++KP+ +Q+ AI P ++G RD++A AQ+G+GKTA F I IL +I Sbjct: 884 EILLHNVGLAGYKKPTPVQKYAI-PIVKGKRDLMACAQTGSGKTAAFLIPILSRI 937 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/54 (42%), Positives = 39/54 (72%), Gaps = 6/54 (11%) Frame = +1 Query: 343 GRDVIAQAQSGTGKTATFSISILQQI-DTSI-----RECQALILAPTRELAQQI 486 G DVI QA++GTGKT +F++ +++++ D + R + L++APTRELA+Q+ Sbjct: 110 GEDVIGQARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQV 163 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/75 (29%), Positives = 41/75 (54%) Frame = +1 Query: 262 ELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIREC 441 +L+ + G KP IQ++A+ + ++ ++++GTGK+ F +L + R Sbjct: 170 KLVEKLKKMGITKPVPIQEKALPSVFSHKSLLIKSETGTGKSLVF---LLPSVQDPGRGY 226 Query: 442 QALILAPTRELAQQI 486 +I+ PTRELA Q+ Sbjct: 227 GTIIVVPTRELASQM 241 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 41.5 bits (93), Expect = 5e-04 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 9/93 (9%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQ------ 417 ++++L+ + A +P+ IQ I I VI AQ+G+GKT + ++ + Sbjct: 386 RDDVLKALDALNIHQPTVIQMVTIPKIIHRHHVICAAQTGSGKTLAYLAPLVHRLREDEE 445 Query: 418 ---IDTSIRECQALILAPTRELAQQIQKVVIAL 507 I ++ +A I+ P RELA QI K +L Sbjct: 446 RHGILARLKRPRACIVVPARELATQILKTAKSL 478 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKT 387 E L + ++KP+ +Q+ +I I GRDV+A AQ+G+GKT Sbjct: 143 EAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGKT 185 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 34.7 bits (76), Expect = 0.057 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 384 E L + + +G+ P+ IQ + + + GRDV+ A +G+GK Sbjct: 205 ESLSKNLSNHGYHSPTPIQMQVLPVLLSGRDVMVCASTGSGK 246 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 31.5 bits (68), Expect = 0.53 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 289 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTS 429 G P+++Q+ ++GRDV A G+GK + + I+ QI S Sbjct: 206 GVTVPTSLQKHMWPSLLRGRDVAGVAIEGSGKRLAYLLPIIHQITES 252 >SB_24825| Best HMM Match : 7tm_1 (HMM E-Value=4.5e-29) Length = 338 Score = 31.1 bits (67), Expect = 0.71 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = -3 Query: 392 VAVFPVPDWA*AITSRPWMQGIIARCWIAEGFSKP-*AYMPLNNSSLGSCHRRFRQLDPS 216 +AVFP+P A + W+ G I +GFS A++ L +L + +R F+ + PS Sbjct: 70 MAVFPMPLSASVLAKGDWLHG--ETLCILQGFSVHFLAFVSLQIMALTALNRYFKVMRPS 127 Query: 215 RCQ 207 +C+ Sbjct: 128 QCR 130 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = +1 Query: 448 LILAPTRELAQQIQKVVIAL 507 L+L PTRELAQQ+Q+V ++ Sbjct: 136 LVLCPTRELAQQVQEVAYSV 155 >SB_5993| Best HMM Match : EGF_2 (HMM E-Value=9e-14) Length = 360 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 501 SSCDHLNAKCHACIGGTNVRED 566 S CDH+ KCH +G T V+ D Sbjct: 123 SICDHVTGKCHCGLGWTGVKCD 144 >SB_48110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 29.9 bits (64), Expect = 1.6 Identities = 24/62 (38%), Positives = 31/62 (50%), Gaps = 7/62 (11%) Frame = +2 Query: 92 PRIESGL*MSEDWPEDSKNGPSKDQGSYDG-----PPGMDPGTLDTDWDQVVETFDD--M 250 P ++SGL D DS GP D G G PGMDPG +D+ D +++ D M Sbjct: 231 PGLDSGLDPGIDPGMDSGMGPGMDSGMDPGLDSRLDPGMDPG-MDSGIDPGLDSGLDPGM 289 Query: 251 NP 256 NP Sbjct: 290 NP 291 >SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) Length = 1366 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/77 (22%), Positives = 33/77 (42%) Frame = +1 Query: 250 EPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTS 429 E E+ + + GF A Q++A+M + G + +G GK+ + + S Sbjct: 508 ETPPEVYKALGQLGFSSFRAGQEQAVMRILSGMSSLVVLSTGAGKSLCYQLPAYMYHKRS 567 Query: 430 IRECQALILAPTRELAQ 480 C L+++P L + Sbjct: 568 --PCLTLVISPLVSLME 582 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +1 Query: 292 FEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTA 390 +EKP+ IQ +AI + GRD+IA + T + A Sbjct: 125 YEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELA 157 >SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +1 Query: 262 ELLRGIYAYGFEKPSAIQQRAIMPC-IQGRDVIAQAQS 372 ++LR + GF KP+ IQ +I P + RD+I A++ Sbjct: 82 DILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAET 119 >SB_55750| Best HMM Match : PWWP (HMM E-Value=6.4e-07) Length = 532 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 337 IQGRDVIAQAQSGTGKTATFSISILQQIDTSIRE 438 + G DV+A + SGT K + F ++++ D+ R+ Sbjct: 245 VNGSDVVANSSSGTVKRSLFLPEVMEENDSVFRD 278 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDH-KSYHHLLNLL 478 H HQ ++ H H H H H H +HH++N++ Sbjct: 263 HHHQHNHHQHHHHHHHHHHNHHHHHQQHHHHHHHHIINII 302 >SB_25304| Best HMM Match : HDV_ag (HMM E-Value=0.55) Length = 2153 Score = 28.7 bits (61), Expect = 3.8 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +1 Query: 295 EKPSAIQQRAIMPCIQGRD-VIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 +KP + A P + G D +I Q+ GKT SI QQ+DT RE Q Sbjct: 1276 DKPPKVSSSA--PSLMGTDEIICQSLEHAGKTPPALSSISQQLDTR-REIQ 1323 Score = 28.7 bits (61), Expect = 3.8 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 295 EKPSAIQQRAIMPCIQGRD-VIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 +KP + A P + G D +I Q++ GKT SI QQ+DT RE Q Sbjct: 1567 DKPPKVSFSA--PSLMGTDEIICQSREHAGKTPPALSSIPQQLDTG-REIQ 1614 >SB_33720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 5.0 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +2 Query: 119 SEDWPEDSKNGPSKDQGSYD---GPPGMDPGTLDTDWDQVVETFDDMNPKKNC 268 +E+ E +K + D+G GPPG GT D VVE DD K C Sbjct: 22 AEEMRELAKKAEACDRGVRAILLGPPGSGKGTQLVSDDLVVELIDDNLTKPEC 74 >SB_44173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 134 EDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMN 253 +D N + D G+ D D GT+D D D V+ DD N Sbjct: 71 DDDGNIDNDDDGNIDND---DDGTIDNDDDGYVDNVDDDN 107 >SB_30467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 134 EDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMN 253 +D N + D G+ D D GT+D D D V+ DD N Sbjct: 54 DDDGNIDNDDDGNIDND---DDGTIDNDDDGYVDNVDDDN 90 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,262,387 Number of Sequences: 59808 Number of extensions: 496364 Number of successful extensions: 2202 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 2033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2185 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -