BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00642 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 56 1e-09 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 2.5 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 3.2 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 24 4.3 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 24 4.3 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 5.7 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 5.7 AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. 23 5.7 AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. 23 7.5 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 23 9.9 AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 9.9 AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucl... 23 9.9 AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deo... 23 9.9 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 23 9.9 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 55.6 bits (128), Expect = 1e-09 Identities = 31/84 (36%), Positives = 50/84 (59%), Gaps = 7/84 (8%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISIL-------Q 414 +EE++ + + KP+ IQ+ AI + GRD++A AQ+G+GKTA F + ++ Sbjct: 182 REEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQTGSGKTAAFMLPMIHHLLDKED 241 Query: 415 QIDTSIRECQALILAPTRELAQQI 486 ++ R +I+APTRELA QI Sbjct: 242 SLELRTRNPYIVIVAPTRELAIQI 265 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.6 bits (51), Expect = 2.5 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 474 GPTNSEGGDSSCDHLNAKCH 533 G +E G S CD +N CH Sbjct: 891 GTEQTEKGISICDAINGNCH 910 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 24.2 bits (50), Expect = 3.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 21 DTIALQVLVAHVFFINILHLC 83 D + Q+L H FF LH+C Sbjct: 919 DFLLAQILSGHRFFREFLHVC 939 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 23.8 bits (49), Expect = 4.3 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 598 TT*TPVSSWRISSRTLVPP 542 TT TP ++ R+++RT PP Sbjct: 319 TTRTPTTTHRLAARTSTPP 337 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 23.8 bits (49), Expect = 4.3 Identities = 11/28 (39%), Positives = 21/28 (75%), Gaps = 3/28 (10%) Frame = +3 Query: 27 IALQVLVAHVFFIN---ILHLCRPPQEL 101 +AL++L+ VF++N +++LC+PP L Sbjct: 486 VALKLLL--VFYVNKCELMYLCQPPARL 511 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.4 bits (48), Expect = 5.7 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 368 SQELEKLLLSLYRFYNKSIQAFVNV 442 S++ E+L+ L+R YNK I+ N+ Sbjct: 24 SEDEERLVRDLFRGYNKLIRPVQNM 48 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.4 bits (48), Expect = 5.7 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -1 Query: 505 ELSPPSEFVGPALLWEPGSKLDIHECLYRF 416 E SP S F G W+ G CL+ F Sbjct: 394 ENSPKSAFTGRIEFWDGGRDFCFLICLFSF 423 >AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 119 SEDWPEDSKNGPSKDQGSY 175 + D SKNGPS Q S+ Sbjct: 100 ARDGSSSSKNGPSNSQASF 118 >AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. Length = 144 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 152 PSKDQGSYDGPPGMDPGTLDTDWDQV 229 P+ G Y PP M PG +D+D Q+ Sbjct: 7 PTSVHGPY--PPHMVPGGVDSDGAQI 30 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 22.6 bits (46), Expect = 9.9 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +2 Query: 23 HNCTASFSSARVFY*YITFVSPTPRIESGL*MSEDW 130 H T S R+F + F +PTP L S W Sbjct: 479 HARTVSNRFVRLFTNFARFGNPTPNAVDTLLQSRQW 514 >AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 107 HSATHALNHSLLKVLGQ 123 >AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 107 HSATHALNHSLLKVLGQ 123 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 108 HSATHALNHSLLKVLGQ 124 >AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 108 HSATHALNHSLLKVLGQ 124 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 107 HSATHALNHSLLKVLGQ 123 >AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 107 HSATHALNHSLLKVLGQ 123 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 91 HSATHALNHSLLKVLGQ 107 >AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 91 HSATHALNHSLLKVLGQ 107 >AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 522 HSSDHKSYHHLLNLLGQ 472 HS+ H H LL +LGQ Sbjct: 121 HSATHALNHSLLKVLGQ 137 >AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucleoside kinase protein. Length = 245 Score = 22.6 bits (46), Expect = 9.9 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +3 Query: 351 CYRSSPVRNWKNC 389 C + PV W+NC Sbjct: 43 CLLTEPVEKWRNC 55 >AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deoxyribonucleoside kinaseprotein. Length = 246 Score = 22.6 bits (46), Expect = 9.9 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +3 Query: 351 CYRSSPVRNWKNC 389 C + PV W+NC Sbjct: 43 CLLTEPVEKWRNC 55 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -1 Query: 208 KCPRVHSRRSIVTTLILRWP 149 +C R R I+TT RWP Sbjct: 8 RCARASPSRPILTTRGRRWP 27 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 713,077 Number of Sequences: 2352 Number of extensions: 16557 Number of successful extensions: 116 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -