BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00642 (598 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X69045-1|CAA48790.1| 402|Drosophila melanogaster eukaryotic tra... 156 2e-38 AY121623-1|AAM51950.1| 403|Drosophila melanogaster GH17619p pro... 156 2e-38 AY069283-1|AAL39428.1| 403|Drosophila melanogaster GM14109p pro... 156 2e-38 AF145621-1|AAD38596.1| 403|Drosophila melanogaster eukaryotic i... 156 2e-38 AE014134-1011|AAN10568.1| 403|Drosophila melanogaster CG9075-PD... 156 2e-38 AE014134-1010|AAN10567.1| 403|Drosophila melanogaster CG9075-PB... 156 2e-38 AE014134-1009|AAN10566.1| 403|Drosophila melanogaster CG9075-PC... 156 2e-38 AE014134-1008|AAF52317.2| 403|Drosophila melanogaster CG9075-PA... 156 2e-38 AY089635-1|AAL90373.1| 399|Drosophila melanogaster RE50350p pro... 141 6e-34 AE014297-735|AAF54221.1| 399|Drosophila melanogaster CG7483-PA ... 141 6e-34 M59926-1|AAA28603.1| 459|Drosophila melanogaster RNA helicase p... 87 2e-17 AY051663-1|AAK93087.1| 459|Drosophila melanogaster LD21247p pro... 87 2e-17 AE014134-1792|AAN10728.1| 428|Drosophila melanogaster CG4916-PB... 87 2e-17 AE014134-1791|AAF52881.2| 459|Drosophila melanogaster CG4916-PA... 87 2e-17 X79802-1|CAA56197.1| 424|Drosophila melanogaster WM6 protein. 74 2e-13 L06018-1|AAB65835.1| 424|Drosophila melanogaster DECD family pu... 74 2e-13 AY118921-1|AAM50781.1| 424|Drosophila melanogaster LD23644p pro... 74 2e-13 AE014134-934|AAN10545.1| 424|Drosophila melanogaster CG7269-PC,... 74 2e-13 AE014134-933|AAN10544.1| 424|Drosophila melanogaster CG7269-PB,... 74 2e-13 AE014134-932|AAF52261.1| 424|Drosophila melanogaster CG7269-PA,... 74 2e-13 AY071389-1|AAL49011.1| 288|Drosophila melanogaster RE44177p pro... 71 1e-12 AF005239-1|AAC23709.1| 460|Drosophila melanogaster DEAD-box hel... 71 1e-12 AY113641-1|AAM29646.1| 388|Drosophila melanogaster RH74035p pro... 69 5e-12 AY075397-1|AAL68229.1| 827|Drosophila melanogaster LD28101p pro... 69 5e-12 AY070624-1|AAL48095.1| 560|Drosophila melanogaster RE72861p pro... 69 5e-12 AF017777-10|AAC28406.1| 560|Drosophila melanogaster helicase pr... 69 5e-12 AE014298-3138|AAF50818.2| 560|Drosophila melanogaster CG1666-PA... 69 5e-12 AE014296-83|AAN11439.1| 827|Drosophila melanogaster CG32344-PA ... 69 5e-12 AF160911-1|AAD46851.1| 1028|Drosophila melanogaster BcDNA.LD0556... 63 3e-10 AE014296-1819|AAF50157.1| 1028|Drosophila melanogaster CG6539-PA... 63 3e-10 AY102660-1|AAM27489.1| 818|Drosophila melanogaster GH10652p pro... 61 1e-09 AE014296-1163|AAF50635.2| 818|Drosophila melanogaster CG10077-P... 61 1e-09 AY121677-1|AAM52004.1| 507|Drosophila melanogaster RE27528p pro... 60 2e-09 AE014134-3342|AAF53963.1| 507|Drosophila melanogaster CG9253-PA... 60 2e-09 AY060404-1|AAL25443.1| 945|Drosophila melanogaster LD32873p pro... 59 5e-09 AE014298-1087|AAF46295.1| 945|Drosophila melanogaster CG10777-P... 59 5e-09 BT021222-1|AAX33370.1| 822|Drosophila melanogaster RH55640p pro... 57 2e-08 AY060822-1|AAL28370.1| 641|Drosophila melanogaster GM01081p pro... 57 2e-08 AE014134-2947|AAF53680.2| 822|Drosophila melanogaster CG10333-P... 57 2e-08 BT016090-1|AAV36975.1| 1224|Drosophila melanogaster LD41277p pro... 56 5e-08 AY051831-1|AAK93255.1| 703|Drosophila melanogaster LD33749p pro... 56 5e-08 AE014298-2134|AAF48446.1| 1224|Drosophila melanogaster CG6227-PA... 56 5e-08 Z23266-1|CAA80804.1| 527|Drosophila melanogaster DEAD-box prote... 54 2e-07 X12945-1|CAA31405.1| 661|Drosophila melanogaster vasa protein. 54 2e-07 L13612-1|AAA16339.1| 527|Drosophila melanogaster DEAD-box prote... 54 2e-07 AY058728-1|AAL13957.1| 521|Drosophila melanogaster LD47509p pro... 54 2e-07 AE013599-778|AAF58994.1| 521|Drosophila melanogaster CG12759-PA... 54 2e-07 U84552-1|AAC27683.1| 663|Drosophila melanogaster helicase pitch... 53 3e-07 AY119620-1|AAM50274.1| 680|Drosophila melanogaster LD46167p pro... 53 3e-07 AY089613-1|AAL90351.1| 798|Drosophila melanogaster RE28061p pro... 53 3e-07 AY071402-1|AAL49024.1| 680|Drosophila melanogaster RE48840p pro... 53 3e-07 AE014297-3091|AAN13900.2| 680|Drosophila melanogaster CG6375-PB... 53 3e-07 AE014297-3090|AAF55951.2| 680|Drosophila melanogaster CG6375-PA... 53 3e-07 AE014297-778|AAF54262.1| 798|Drosophila melanogaster CG9748-PA ... 53 3e-07 AY051513-1|AAK92937.1| 613|Drosophila melanogaster GH16590p pro... 52 4e-07 AE014297-721|AAF54208.1| 613|Drosophila melanogaster CG9630-PA ... 52 4e-07 AE014296-2963|AAF49303.1| 594|Drosophila melanogaster CG5589-PA... 52 4e-07 AE014134-2564|AAF53438.1| 661|Drosophila melanogaster CG3506-PA... 52 4e-07 AY061400-1|AAL28948.1| 791|Drosophila melanogaster LD32732p pro... 52 6e-07 AE014296-1853|AAF50131.1| 791|Drosophila melanogaster CG6418-PB... 52 6e-07 M23560-1|AAA29013.1| 648|Drosophila melanogaster protein ( D.me... 52 8e-07 AY119628-1|AAM50282.1| 826|Drosophila melanogaster RE19835p pro... 51 1e-06 AE014298-2591|AAF48747.2| 826|Drosophila melanogaster CG5800-PA... 51 1e-06 BT004908-1|AAO49161.1| 782|Drosophila melanogaster LD15481p pro... 49 4e-06 AF181659-1|AAD55444.1| 641|Drosophila melanogaster BcDNA.GM0530... 49 4e-06 AF145609-1|AAD38584.1| 974|Drosophila melanogaster BcDNA.GH0283... 49 4e-06 AE014298-2568|AAO41693.1| 975|Drosophila melanogaster CG8611-PB... 49 4e-06 AE014298-2567|AAF48727.2| 974|Drosophila melanogaster CG8611-PA... 49 4e-06 AE013599-611|AAF59119.1| 782|Drosophila melanogaster CG2173-PA ... 49 4e-06 X52846-1|CAA37037.1| 575|Drosophila melanogaster protein ( Dros... 48 1e-05 BT015209-1|AAT94438.1| 575|Drosophila melanogaster RE56857p pro... 48 1e-05 BT011476-1|AAR99134.1| 719|Drosophila melanogaster RE11923p pro... 48 1e-05 BT001716-1|AAN71471.1| 578|Drosophila melanogaster RE68337p pro... 48 1e-05 AE014297-394|AAG22212.1| 578|Drosophila melanogaster CG10279-PF... 48 1e-05 AE014297-393|AAN14332.1| 578|Drosophila melanogaster CG10279-PC... 48 1e-05 AE014297-392|AAF51926.2| 578|Drosophila melanogaster CG10279-PB... 48 1e-05 AE014297-391|AAF51927.2| 578|Drosophila melanogaster CG10279-PE... 48 1e-05 AE014297-390|AAN14331.1| 575|Drosophila melanogaster CG10279-PD... 48 1e-05 AE014297-389|AAG22213.2| 719|Drosophila melanogaster CG10279-PA... 48 1e-05 AY051752-1|AAK93176.1| 619|Drosophila melanogaster LD28839p pro... 46 3e-05 AF212866-1|AAF19985.1| 619|Drosophila melanogaster abstrakt pro... 46 3e-05 AF187729-1|AAF04040.1| 614|Drosophila melanogaster DEAD-box pro... 46 3e-05 AE014297-15|AAF52165.1| 619|Drosophila melanogaster CG14637-PA ... 46 3e-05 M74824-1|AAC14192.1| 644|Drosophila melanogaster D-E-A-D box pr... 45 9e-05 BT010045-1|AAQ22514.1| 687|Drosophila melanogaster LD27814p pro... 45 9e-05 AF132173-1|AAD34761.1| 687|Drosophila melanogaster unknown prot... 45 9e-05 AE014296-2792|AAF49419.1| 687|Drosophila melanogaster CG9680-PA... 45 9e-05 AY058515-1|AAL13744.1| 680|Drosophila melanogaster LD21880p pro... 40 0.003 U34773-1|AAC47309.1| 725|Drosophila melanogaster DEAD-box prote... 38 0.010 AY119661-1|AAM50315.1| 727|Drosophila melanogaster SD05527p pro... 38 0.010 AE014296-3658|AAF51814.1| 727|Drosophila melanogaster CG9054-PA... 38 0.010 AY084126-1|AAL89864.1| 376|Drosophila melanogaster RE20606p pro... 37 0.018 AF239691-1|AAF85950.1| 108|Drosophila melanogaster unknown prot... 36 0.042 AY058512-1|AAL13741.1| 536|Drosophila melanogaster LD21669p pro... 35 0.096 AE014134-152|AAF51458.1| 536|Drosophila melanogaster CG3561-PA ... 35 0.096 AE014298-1416|AAF46559.1| 1161|Drosophila melanogaster CG15311-P... 33 0.39 AE014298-2611|AAF48765.3| 1039|Drosophila melanogaster CG8146-PA... 30 2.1 AE014296-1744|AAF50205.1| 154|Drosophila melanogaster CG14173-P... 29 4.8 DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup prote... 28 8.4 DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup prote... 28 8.4 AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p pro... 28 8.4 AY051923-1|AAK93347.1| 806|Drosophila melanogaster LD40758p pro... 28 8.4 AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transm... 28 8.4 AF070064-1|AAC72898.1| 1296|Drosophila melanogaster cap 'n' coll... 28 8.4 AF070063-1|AAC72897.1| 805|Drosophila melanogaster cap 'n' coll... 28 8.4 AE014297-3288|AAF56109.2| 805|Drosophila melanogaster CG17894-P... 28 8.4 AE014297-3287|AAF56111.2| 1383|Drosophila melanogaster CG17894-P... 28 8.4 AE014297-3274|AAF56099.3| 806|Drosophila melanogaster CG4656-PA... 28 8.4 AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-P... 28 8.4 >X69045-1|CAA48790.1| 402|Drosophila melanogaster eukaryotic translation initiationfactor 4A (eIF-4A) protein. Length = 402 Score = 156 bits (379), Expect = 2e-38 Identities = 75/84 (89%), Positives = 82/84 (97%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 +EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGTGKTATFSI+ILQQIDTSIR Sbjct: 38 REELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIR 97 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 ECQALILAPTRELA QIQ+VV+AL Sbjct: 98 ECQALILAPTRELATQIQRVVMAL 121 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 +++ HACIGGTNVRED R LE+G HV Sbjct: 123 EYMKVHSHACIGGTNVREDARILESGCHV 151 Score = 35.1 bits (77), Expect = 0.073 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 176 DGPPGMDP-GTLDTDWDQVVETFDDMN 253 DGP M+P G +++ W +V + FDDMN Sbjct: 10 DGPASMEPEGVIESTWHEVYDNFDDMN 36 >AY121623-1|AAM51950.1| 403|Drosophila melanogaster GH17619p protein. Length = 403 Score = 156 bits (379), Expect = 2e-38 Identities = 75/84 (89%), Positives = 82/84 (97%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 +EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGTGKTATFSI+ILQQIDTSIR Sbjct: 38 REELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIR 97 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 ECQALILAPTRELA QIQ+VV+AL Sbjct: 98 ECQALILAPTRELATQIQRVVMAL 121 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 +++ HACIGGTNVRED R LE+G HV Sbjct: 123 EYMKVHSHACIGGTNVREDARILESGCHV 151 Score = 35.1 bits (77), Expect = 0.073 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 176 DGPPGMDP-GTLDTDWDQVVETFDDMN 253 DGP M+P G +++ W +V + FDDMN Sbjct: 10 DGPASMEPEGVIESTWHEVYDNFDDMN 36 >AY069283-1|AAL39428.1| 403|Drosophila melanogaster GM14109p protein. Length = 403 Score = 156 bits (379), Expect = 2e-38 Identities = 75/84 (89%), Positives = 82/84 (97%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 +EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGTGKTATFSI+ILQQIDTSIR Sbjct: 38 REELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIR 97 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 ECQALILAPTRELA QIQ+VV+AL Sbjct: 98 ECQALILAPTRELATQIQRVVMAL 121 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 +++ HACIGGTNVRED R LE+G HV Sbjct: 123 EYMKVHSHACIGGTNVREDARILESGCHV 151 Score = 35.1 bits (77), Expect = 0.073 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 176 DGPPGMDP-GTLDTDWDQVVETFDDMN 253 DGP M+P G +++ W +V + FDDMN Sbjct: 10 DGPASMEPEGVIESTWHEVYDNFDDMN 36 >AF145621-1|AAD38596.1| 403|Drosophila melanogaster eukaryotic initiation factor-4a protein. Length = 403 Score = 156 bits (379), Expect = 2e-38 Identities = 75/84 (89%), Positives = 82/84 (97%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 +EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGTGKTATFSI+ILQQIDTSIR Sbjct: 38 REELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIR 97 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 ECQALILAPTRELA QIQ+VV+AL Sbjct: 98 ECQALILAPTRELATQIQRVVMAL 121 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 +++ HACIGGTNVRED R LE+G HV Sbjct: 123 EYMKVHSHACIGGTNVREDARILESGCHV 151 Score = 35.1 bits (77), Expect = 0.073 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 176 DGPPGMDP-GTLDTDWDQVVETFDDMN 253 DGP M+P G +++ W +V + FDDMN Sbjct: 10 DGPASMEPEGVIESTWHEVYDNFDDMN 36 >AE014134-1011|AAN10568.1| 403|Drosophila melanogaster CG9075-PD, isoform D protein. Length = 403 Score = 156 bits (379), Expect = 2e-38 Identities = 75/84 (89%), Positives = 82/84 (97%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 +EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGTGKTATFSI+ILQQIDTSIR Sbjct: 38 REELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIR 97 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 ECQALILAPTRELA QIQ+VV+AL Sbjct: 98 ECQALILAPTRELATQIQRVVMAL 121 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 +++ HACIGGTNVRED R LE+G HV Sbjct: 123 EYMKVHSHACIGGTNVREDARILESGCHV 151 Score = 35.1 bits (77), Expect = 0.073 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 176 DGPPGMDP-GTLDTDWDQVVETFDDMN 253 DGP M+P G +++ W +V + FDDMN Sbjct: 10 DGPASMEPEGVIESTWHEVYDNFDDMN 36 >AE014134-1010|AAN10567.1| 403|Drosophila melanogaster CG9075-PB, isoform B protein. Length = 403 Score = 156 bits (379), Expect = 2e-38 Identities = 75/84 (89%), Positives = 82/84 (97%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 +EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGTGKTATFSI+ILQQIDTSIR Sbjct: 38 REELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIR 97 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 ECQALILAPTRELA QIQ+VV+AL Sbjct: 98 ECQALILAPTRELATQIQRVVMAL 121 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 +++ HACIGGTNVRED R LE+G HV Sbjct: 123 EYMKVHSHACIGGTNVREDARILESGCHV 151 Score = 35.1 bits (77), Expect = 0.073 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 176 DGPPGMDP-GTLDTDWDQVVETFDDMN 253 DGP M+P G +++ W +V + FDDMN Sbjct: 10 DGPASMEPEGVIESTWHEVYDNFDDMN 36 >AE014134-1009|AAN10566.1| 403|Drosophila melanogaster CG9075-PC, isoform C protein. Length = 403 Score = 156 bits (379), Expect = 2e-38 Identities = 75/84 (89%), Positives = 82/84 (97%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 +EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGTGKTATFSI+ILQQIDTSIR Sbjct: 38 REELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIR 97 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 ECQALILAPTRELA QIQ+VV+AL Sbjct: 98 ECQALILAPTRELATQIQRVVMAL 121 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 +++ HACIGGTNVRED R LE+G HV Sbjct: 123 EYMKVHSHACIGGTNVREDARILESGCHV 151 Score = 35.1 bits (77), Expect = 0.073 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 176 DGPPGMDP-GTLDTDWDQVVETFDDMN 253 DGP M+P G +++ W +V + FDDMN Sbjct: 10 DGPASMEPEGVIESTWHEVYDNFDDMN 36 >AE014134-1008|AAF52317.2| 403|Drosophila melanogaster CG9075-PA, isoform A protein. Length = 403 Score = 156 bits (379), Expect = 2e-38 Identities = 75/84 (89%), Positives = 82/84 (97%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 +EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGTGKTATFSI+ILQQIDTSIR Sbjct: 38 REELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIR 97 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 ECQALILAPTRELA QIQ+VV+AL Sbjct: 98 ECQALILAPTRELATQIQRVVMAL 121 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 +++ HACIGGTNVRED R LE+G HV Sbjct: 123 EYMKVHSHACIGGTNVREDARILESGCHV 151 Score = 35.1 bits (77), Expect = 0.073 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 176 DGPPGMDP-GTLDTDWDQVVETFDDMN 253 DGP M+P G +++ W +V + FDDMN Sbjct: 10 DGPASMEPEGVIESTWHEVYDNFDDMN 36 >AY089635-1|AAL90373.1| 399|Drosophila melanogaster RE50350p protein. Length = 399 Score = 141 bits (342), Expect = 6e-34 Identities = 68/84 (80%), Positives = 77/84 (91%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 KEELLRGIYAYGFEKPSAIQQR+I P ++GRDVIAQAQSGTGKTATFSISILQ +DT++R Sbjct: 34 KEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQSLDTTLR 93 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 E Q L L+PTRELA QIQKV++AL Sbjct: 94 ETQVLCLSPTRELAVQIQKVILAL 117 Score = 46.4 bits (105), Expect = 3e-05 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 D +N +CH CIGGTN+ EDIR+L+ G H+ Sbjct: 119 DMMNVQCHVCIGGTNLGEDIRKLDYGQHI 147 >AE014297-735|AAF54221.1| 399|Drosophila melanogaster CG7483-PA protein. Length = 399 Score = 141 bits (342), Expect = 6e-34 Identities = 68/84 (80%), Positives = 77/84 (91%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 KEELLRGIYAYGFEKPSAIQQR+I P ++GRDVIAQAQSGTGKTATFSISILQ +DT++R Sbjct: 34 KEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQSLDTTLR 93 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 E Q L L+PTRELA QIQKV++AL Sbjct: 94 ETQVLCLSPTRELAVQIQKVILAL 117 Score = 46.4 bits (105), Expect = 3e-05 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = +3 Query: 510 DHLNAKCHACIGGTNVREDIRQLETGVHV 596 D +N +CH CIGGTN+ EDIR+L+ G H+ Sbjct: 119 DMMNVQCHVCIGGTNLGEDIRKLDYGQHI 147 >M59926-1|AAA28603.1| 459|Drosophila melanogaster RNA helicase protein. Length = 459 Score = 86.6 bits (205), Expect = 2e-17 Identities = 41/84 (48%), Positives = 59/84 (70%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K ELL GI+ G+E+PS IQ+ AI + G+DV+A+A++GTGKT + I +L+QID + Sbjct: 66 KRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQIDPTKD 125 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 QAL++ PTRELA Q ++ I L Sbjct: 126 YIQALVMVPTRELALQTSQICIEL 149 >AY051663-1|AAK93087.1| 459|Drosophila melanogaster LD21247p protein. Length = 459 Score = 86.6 bits (205), Expect = 2e-17 Identities = 41/84 (48%), Positives = 59/84 (70%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K ELL GI+ G+E+PS IQ+ AI + G+DV+A+A++GTGKT + I +L+QID + Sbjct: 66 KRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQIDPTKD 125 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 QAL++ PTRELA Q ++ I L Sbjct: 126 YIQALVMVPTRELALQTSQICIEL 149 >AE014134-1792|AAN10728.1| 428|Drosophila melanogaster CG4916-PB, isoform B protein. Length = 428 Score = 86.6 bits (205), Expect = 2e-17 Identities = 41/84 (48%), Positives = 59/84 (70%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K ELL GI+ G+E+PS IQ+ AI + G+DV+A+A++GTGKT + I +L+QID + Sbjct: 35 KRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQIDPTKD 94 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 QAL++ PTRELA Q ++ I L Sbjct: 95 YIQALVMVPTRELALQTSQICIEL 118 >AE014134-1791|AAF52881.2| 459|Drosophila melanogaster CG4916-PA, isoform A protein. Length = 459 Score = 86.6 bits (205), Expect = 2e-17 Identities = 41/84 (48%), Positives = 59/84 (70%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K ELL GI+ G+E+PS IQ+ AI + G+DV+A+A++GTGKT + I +L+QID + Sbjct: 66 KRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQIDPTKD 125 Query: 436 ECQALILAPTRELAQQIQKVVIAL 507 QAL++ PTRELA Q ++ I L Sbjct: 126 YIQALVMVPTRELALQTSQICIEL 149 >X79802-1|CAA56197.1| 424|Drosophila melanogaster WM6 protein. Length = 424 Score = 73.7 bits (173), Expect = 2e-13 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 1/80 (1%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K E+LR I GFE PS +Q I + G D++ QA+SG GKTA F ++ LQQ++ S Sbjct: 49 KPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVLATLQQLEPSDN 108 Query: 436 E-CQALILAPTRELAQQIQK 492 C L++ TRELA QI K Sbjct: 109 NTCHVLVMCHTRELAFQISK 128 >L06018-1|AAB65835.1| 424|Drosophila melanogaster DECD family putative RNA helicase protein. Length = 424 Score = 73.7 bits (173), Expect = 2e-13 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 1/80 (1%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K E+LR I GFE PS +Q I + G D++ QA+SG GKTA F ++ LQQ++ S Sbjct: 49 KPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVLATLQQLEPSDN 108 Query: 436 E-CQALILAPTRELAQQIQK 492 C L++ TRELA QI K Sbjct: 109 NTCHVLVMCHTRELAFQISK 128 >AY118921-1|AAM50781.1| 424|Drosophila melanogaster LD23644p protein. Length = 424 Score = 73.7 bits (173), Expect = 2e-13 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 1/80 (1%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K E+LR I GFE PS +Q I + G D++ QA+SG GKTA F ++ LQQ++ S Sbjct: 49 KPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVLATLQQLEPSDN 108 Query: 436 E-CQALILAPTRELAQQIQK 492 C L++ TRELA QI K Sbjct: 109 NTCHVLVMCHTRELAFQISK 128 >AE014134-934|AAN10545.1| 424|Drosophila melanogaster CG7269-PC, isoform C protein. Length = 424 Score = 73.7 bits (173), Expect = 2e-13 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 1/80 (1%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K E+LR I GFE PS +Q I + G D++ QA+SG GKTA F ++ LQQ++ S Sbjct: 49 KPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVLATLQQLEPSDN 108 Query: 436 E-CQALILAPTRELAQQIQK 492 C L++ TRELA QI K Sbjct: 109 NTCHVLVMCHTRELAFQISK 128 >AE014134-933|AAN10544.1| 424|Drosophila melanogaster CG7269-PB, isoform B protein. Length = 424 Score = 73.7 bits (173), Expect = 2e-13 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 1/80 (1%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K E+LR I GFE PS +Q I + G D++ QA+SG GKTA F ++ LQQ++ S Sbjct: 49 KPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVLATLQQLEPSDN 108 Query: 436 E-CQALILAPTRELAQQIQK 492 C L++ TRELA QI K Sbjct: 109 NTCHVLVMCHTRELAFQISK 128 >AE014134-932|AAF52261.1| 424|Drosophila melanogaster CG7269-PA, isoform A protein. Length = 424 Score = 73.7 bits (173), Expect = 2e-13 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 1/80 (1%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR 435 K E+LR I GFE PS +Q I + G D++ QA+SG GKTA F ++ LQQ++ S Sbjct: 49 KPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVLATLQQLEPSDN 108 Query: 436 E-CQALILAPTRELAQQIQK 492 C L++ TRELA QI K Sbjct: 109 NTCHVLVMCHTRELAFQISK 128 >AY071389-1|AAL49011.1| 288|Drosophila melanogaster RE44177p protein. Length = 288 Score = 70.9 bits (166), Expect = 1e-12 Identities = 37/82 (45%), Positives = 54/82 (65%), Gaps = 2/82 (2%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGKTATFSISILQQIDTS 429 K LL+GIYA GF PS IQ+ A+ + +++IAQ+QSGTGKTA F +++L +++ Sbjct: 81 KASLLKGIYAMGFNTPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAMLSRVNVC 140 Query: 430 IRECQALILAPTRELAQQIQKV 495 + Q L L+PT ELA Q +V Sbjct: 141 LNHPQVLCLSPTYELAIQTGEV 162 >AF005239-1|AAC23709.1| 460|Drosophila melanogaster DEAD-box helicase protein. Length = 460 Score = 70.9 bits (166), Expect = 1e-12 Identities = 37/82 (45%), Positives = 54/82 (65%), Gaps = 2/82 (2%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGKTATFSISILQQIDTS 429 K LL+GIYA GF PS IQ+ A+ + +++IAQ+QSGTGKTA F +++L +++ Sbjct: 81 KASLLKGIYAMGFNTPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAMLSRVNVC 140 Query: 430 IRECQALILAPTRELAQQIQKV 495 + Q L L+PT ELA Q +V Sbjct: 141 LNHPQVLCLSPTYELAIQTGEV 162 >AY113641-1|AAM29646.1| 388|Drosophila melanogaster RH74035p protein. Length = 388 Score = 68.9 bits (161), Expect = 5e-12 Identities = 33/92 (35%), Positives = 63/92 (68%), Gaps = 5/92 (5%) Frame = +1 Query: 250 EPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI--- 420 E + +L+ + G+++P+ IQ AI ++G+DV+ +A++G+GKTAT+++ ++Q+I Sbjct: 15 ELDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGKTATYALPLIQKILNS 74 Query: 421 --DTSIRECQALILAPTRELAQQIQKVVIALV 510 + S + A++LAPT+EL +Q +KV+ LV Sbjct: 75 KLNASEQYVSAVVLAPTKELCRQSRKVIEQLV 106 >AY075397-1|AAL68229.1| 827|Drosophila melanogaster LD28101p protein. Length = 827 Score = 68.9 bits (161), Expect = 5e-12 Identities = 34/81 (41%), Positives = 55/81 (67%), Gaps = 2/81 (2%) Frame = +1 Query: 262 ELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQID--TSIR 435 EL++GI G++ P+ IQ++ I ++GRDV+A A++G+GKTA F I + +++ + Sbjct: 49 ELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEKLQRREPTK 108 Query: 436 ECQALILAPTRELAQQIQKVV 498 +ALIL+PTRELA Q K + Sbjct: 109 GARALILSPTRELAVQTYKFI 129 >AY070624-1|AAL48095.1| 560|Drosophila melanogaster RE72861p protein. Length = 560 Score = 68.9 bits (161), Expect = 5e-12 Identities = 33/92 (35%), Positives = 63/92 (68%), Gaps = 5/92 (5%) Frame = +1 Query: 250 EPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI--- 420 E + +L+ + G+++P+ IQ AI ++G+DV+ +A++G+GKTAT+++ ++Q+I Sbjct: 15 ELDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGKTATYALPLIQKILNS 74 Query: 421 --DTSIRECQALILAPTRELAQQIQKVVIALV 510 + S + A++LAPT+EL +Q +KV+ LV Sbjct: 75 KLNASEQYVSAVVLAPTKELCRQSRKVIEQLV 106 >AF017777-10|AAC28406.1| 560|Drosophila melanogaster helicase protein. Length = 560 Score = 68.9 bits (161), Expect = 5e-12 Identities = 33/92 (35%), Positives = 63/92 (68%), Gaps = 5/92 (5%) Frame = +1 Query: 250 EPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI--- 420 E + +L+ + G+++P+ IQ AI ++G+DV+ +A++G+GKTAT+++ ++Q+I Sbjct: 15 ELDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGKTATYALPLIQKILNS 74 Query: 421 --DTSIRECQALILAPTRELAQQIQKVVIALV 510 + S + A++LAPT+EL +Q +KV+ LV Sbjct: 75 KLNASEQYVSAVVLAPTKELCRQSRKVIEQLV 106 >AE014298-3138|AAF50818.2| 560|Drosophila melanogaster CG1666-PA protein. Length = 560 Score = 68.9 bits (161), Expect = 5e-12 Identities = 33/92 (35%), Positives = 63/92 (68%), Gaps = 5/92 (5%) Frame = +1 Query: 250 EPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI--- 420 E + +L+ + G+++P+ IQ AI ++G+DV+ +A++G+GKTAT+++ ++Q+I Sbjct: 15 ELDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGKTATYALPLIQKILNS 74 Query: 421 --DTSIRECQALILAPTRELAQQIQKVVIALV 510 + S + A++LAPT+EL +Q +KV+ LV Sbjct: 75 KLNASEQYVSAVVLAPTKELCRQSRKVIEQLV 106 >AE014296-83|AAN11439.1| 827|Drosophila melanogaster CG32344-PA protein. Length = 827 Score = 68.9 bits (161), Expect = 5e-12 Identities = 34/81 (41%), Positives = 55/81 (67%), Gaps = 2/81 (2%) Frame = +1 Query: 262 ELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQID--TSIR 435 EL++GI G++ P+ IQ++ I ++GRDV+A A++G+GKTA F I + +++ + Sbjct: 49 ELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEKLQRREPTK 108 Query: 436 ECQALILAPTRELAQQIQKVV 498 +ALIL+PTRELA Q K + Sbjct: 109 GARALILSPTRELAVQTYKFI 129 >AF160911-1|AAD46851.1| 1028|Drosophila melanogaster BcDNA.LD05563 protein. Length = 1028 Score = 62.9 bits (146), Expect = 3e-10 Identities = 31/75 (41%), Positives = 47/75 (62%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 LL G+ F P+ IQ AI + D+I Q++SGTGKT + I+++Q + +I + Sbjct: 36 LLNGLKRNNFVTPTKIQAAAIPMALAKMDLIIQSKSGTGKTLIYVIAVVQSFNPNINQPH 95 Query: 445 ALILAPTRELAQQIQ 489 A+I+ PTRELA Q+Q Sbjct: 96 AMIVVPTRELAIQVQ 110 >AE014296-1819|AAF50157.1| 1028|Drosophila melanogaster CG6539-PA protein. Length = 1028 Score = 62.9 bits (146), Expect = 3e-10 Identities = 31/75 (41%), Positives = 47/75 (62%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 LL G+ F P+ IQ AI + D+I Q++SGTGKT + I+++Q + +I + Sbjct: 36 LLNGLKRNNFVTPTKIQAAAIPMALAKMDLIIQSKSGTGKTLIYVIAVVQSFNPNINQPH 95 Query: 445 ALILAPTRELAQQIQ 489 A+I+ PTRELA Q+Q Sbjct: 96 AMIVVPTRELAIQVQ 110 >AY102660-1|AAM27489.1| 818|Drosophila melanogaster GH10652p protein. Length = 818 Score = 60.9 bits (141), Expect = 1e-09 Identities = 35/84 (41%), Positives = 51/84 (60%), Gaps = 5/84 (5%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 ++ I GF KP+AIQ + + GRD++ AQ+G+GKT + + + I+ R + Sbjct: 168 VMNEIRKQGFAKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTLAYVLPAVVHINNQPRLER 227 Query: 445 -----ALILAPTRELAQQIQKVVI 501 AL+LAPTRELAQQIQ+V I Sbjct: 228 GDGPIALVLAPTRELAQQIQQVAI 251 >AE014296-1163|AAF50635.2| 818|Drosophila melanogaster CG10077-PA, isoform A protein. Length = 818 Score = 60.9 bits (141), Expect = 1e-09 Identities = 35/84 (41%), Positives = 51/84 (60%), Gaps = 5/84 (5%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 ++ I GF KP+AIQ + + GRD++ AQ+G+GKT + + + I+ R + Sbjct: 168 VMNEIRKQGFAKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTLAYVLPAVVHINNQPRLER 227 Query: 445 -----ALILAPTRELAQQIQKVVI 501 AL+LAPTRELAQQIQ+V I Sbjct: 228 GDGPIALVLAPTRELAQQIQQVAI 251 >AY121677-1|AAM52004.1| 507|Drosophila melanogaster RE27528p protein. Length = 507 Score = 60.5 bits (140), Expect = 2e-09 Identities = 32/72 (44%), Positives = 47/72 (65%) Frame = +1 Query: 292 FEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRE 471 ++ PS IQ+ AI +QG+DVI A++G+GKT F++ IL + + + AL+L PTRE Sbjct: 81 WKAPSKIQREAIPVALQGKDVIGLAETGSGKTGAFALPILHALLENPQRYFALVLTPTRE 140 Query: 472 LAQQIQKVVIAL 507 LA QI + AL Sbjct: 141 LAFQIGEQFEAL 152 >AE014134-3342|AAF53963.1| 507|Drosophila melanogaster CG9253-PA protein. Length = 507 Score = 60.5 bits (140), Expect = 2e-09 Identities = 32/72 (44%), Positives = 47/72 (65%) Frame = +1 Query: 292 FEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRE 471 ++ PS IQ+ AI +QG+DVI A++G+GKT F++ IL + + + AL+L PTRE Sbjct: 81 WKAPSKIQREAIPVALQGKDVIGLAETGSGKTGAFALPILHALLENPQRYFALVLTPTRE 140 Query: 472 LAQQIQKVVIAL 507 LA QI + AL Sbjct: 141 LAFQIGEQFEAL 152 >AY060404-1|AAL25443.1| 945|Drosophila melanogaster LD32873p protein. Length = 945 Score = 58.8 bits (136), Expect = 5e-09 Identities = 35/75 (46%), Positives = 46/75 (61%), Gaps = 5/75 (6%) Frame = +1 Query: 289 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTS---IR--ECQALI 453 GF KP+AIQ + + GRD++ AQ+G+GKT + + + I IR AL+ Sbjct: 256 GFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQPPIIRGEGPIALV 315 Query: 454 LAPTRELAQQIQKVV 498 LAPTRELAQQIQ VV Sbjct: 316 LAPTRELAQQIQSVV 330 >AE014298-1087|AAF46295.1| 945|Drosophila melanogaster CG10777-PB protein. Length = 945 Score = 58.8 bits (136), Expect = 5e-09 Identities = 35/75 (46%), Positives = 46/75 (61%), Gaps = 5/75 (6%) Frame = +1 Query: 289 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTS---IR--ECQALI 453 GF KP+AIQ + + GRD++ AQ+G+GKT + + + I IR AL+ Sbjct: 256 GFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQPPIIRGEGPIALV 315 Query: 454 LAPTRELAQQIQKVV 498 LAPTRELAQQIQ VV Sbjct: 316 LAPTRELAQQIQSVV 330 >BT021222-1|AAX33370.1| 822|Drosophila melanogaster RH55640p protein. Length = 822 Score = 57.2 bits (132), Expect = 2e-08 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 9/87 (10%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT--SI 432 +E++ I G+++P+ IQ++AI +Q RD+I A++G+GKT F I +L I + I Sbjct: 403 KEIIDIIDKVGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTLAFLIPLLSWIQSLPKI 462 Query: 433 RECQ-------ALILAPTRELAQQIQK 492 + A+I+APTRELAQQI++ Sbjct: 463 ERLEDVDQGPYAIIMAPTRELAQQIEE 489 >AY060822-1|AAL28370.1| 641|Drosophila melanogaster GM01081p protein. Length = 641 Score = 57.2 bits (132), Expect = 2e-08 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 9/87 (10%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT--SI 432 +E++ I G+++P+ IQ++AI +Q RD+I A++G+GKT F I +L I + I Sbjct: 222 KEIIDIIDKVGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTLAFLIPLLSWIQSLPKI 281 Query: 433 RECQ-------ALILAPTRELAQQIQK 492 + A+I+APTRELAQQI++ Sbjct: 282 ERLEDVDQGPYAIIMAPTRELAQQIEE 308 >AE014134-2947|AAF53680.2| 822|Drosophila melanogaster CG10333-PA protein. Length = 822 Score = 57.2 bits (132), Expect = 2e-08 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 9/87 (10%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT--SI 432 +E++ I G+++P+ IQ++AI +Q RD+I A++G+GKT F I +L I + I Sbjct: 403 KEIIDIIDKVGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTLAFLIPLLSWIQSLPKI 462 Query: 433 RECQ-------ALILAPTRELAQQIQK 492 + A+I+APTRELAQQI++ Sbjct: 463 ERLEDVDQGPYAIIMAPTRELAQQIEE 489 >BT016090-1|AAV36975.1| 1224|Drosophila melanogaster LD41277p protein. Length = 1224 Score = 55.6 bits (128), Expect = 5e-08 Identities = 33/73 (45%), Positives = 45/73 (61%), Gaps = 5/73 (6%) Frame = +1 Query: 289 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI-DTSIRE----CQALI 453 GFEKP+ IQ +AI + GRD+I A++G+GKT F + + + I D E A+I Sbjct: 529 GFEKPTPIQCQAIPAIMSGRDLIGIAKTGSGKTLAFILPMFRHILDQPSMEDGDGAIAII 588 Query: 454 LAPTRELAQQIQK 492 +APTREL QI K Sbjct: 589 MAPTRELCMQIGK 601 >AY051831-1|AAK93255.1| 703|Drosophila melanogaster LD33749p protein. Length = 703 Score = 55.6 bits (128), Expect = 5e-08 Identities = 36/85 (42%), Positives = 48/85 (56%), Gaps = 6/85 (7%) Frame = +1 Query: 262 ELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSI--SILQQIDTSIR 435 ++L I GF KPS IQ +A +QG D+I AQ+GTGKT F + I + ++ R Sbjct: 293 DMLEEITKMGFSKPSPIQSQAWPILLQGHDMIGIAQTGTGKTLAFLLPGMIHTEYQSTPR 352 Query: 436 ----ECQALILAPTRELAQQIQKVV 498 L+LAPTRELA QI+ V Sbjct: 353 GTRGGANVLVLAPTRELALQIEMEV 377 >AE014298-2134|AAF48446.1| 1224|Drosophila melanogaster CG6227-PA protein. Length = 1224 Score = 55.6 bits (128), Expect = 5e-08 Identities = 33/73 (45%), Positives = 45/73 (61%), Gaps = 5/73 (6%) Frame = +1 Query: 289 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI-DTSIRE----CQALI 453 GFEKP+ IQ +AI + GRD+I A++G+GKT F + + + I D E A+I Sbjct: 529 GFEKPTPIQCQAIPAIMSGRDLIGIAKTGSGKTLAFILPMFRHILDQPSMEDGDGAIAII 588 Query: 454 LAPTRELAQQIQK 492 +APTREL QI K Sbjct: 589 MAPTRELCMQIGK 601 >Z23266-1|CAA80804.1| 527|Drosophila melanogaster DEAD-box protein protein. Length = 527 Score = 53.6 bits (123), Expect = 2e-07 Identities = 27/76 (35%), Positives = 45/76 (59%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 L++ + G + + IQQ+ I + G+D I A++G+GKT F++ IL+++ Sbjct: 18 LVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILERLSEEPVSHF 77 Query: 445 ALILAPTRELAQQIQK 492 AL+L PT ELA QI + Sbjct: 78 ALVLTPTHELAYQISE 93 >X12945-1|CAA31405.1| 661|Drosophila melanogaster vasa protein. Length = 661 Score = 53.6 bits (123), Expect = 2e-07 Identities = 30/82 (36%), Positives = 51/82 (62%), Gaps = 5/82 (6%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI----- 420 ++ ++ + GF+ P+ IQ+ +I GRD++A AQ+G+GKTA F + IL ++ Sbjct: 253 RDIIIDNVNKSGFKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPH 312 Query: 421 DTSIRECQALILAPTRELAQQI 486 + + Q +I++PTRELA QI Sbjct: 313 ELELGRPQVVIVSPTRELAIQI 334 >L13612-1|AAA16339.1| 527|Drosophila melanogaster DEAD-box protein protein. Length = 527 Score = 53.6 bits (123), Expect = 2e-07 Identities = 27/76 (35%), Positives = 45/76 (59%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 L++ + G + + IQQ+ I + G+D I A++G+GKT F++ IL+++ Sbjct: 18 LVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILERLSEEPVSHF 77 Query: 445 ALILAPTRELAQQIQK 492 AL+L PT ELA QI + Sbjct: 78 ALVLTPTHELAYQISE 93 >AY058728-1|AAL13957.1| 521|Drosophila melanogaster LD47509p protein. Length = 521 Score = 53.6 bits (123), Expect = 2e-07 Identities = 27/76 (35%), Positives = 45/76 (59%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 L++ + G + + IQQ+ I + G+D I A++G+GKT F++ IL+++ Sbjct: 18 LVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILERLSEEPVSHF 77 Query: 445 ALILAPTRELAQQIQK 492 AL+L PT ELA QI + Sbjct: 78 ALVLTPTHELAYQISE 93 >AE013599-778|AAF58994.1| 521|Drosophila melanogaster CG12759-PA protein. Length = 521 Score = 53.6 bits (123), Expect = 2e-07 Identities = 27/76 (35%), Positives = 45/76 (59%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 L++ + G + + IQQ+ I + G+D I A++G+GKT F++ IL+++ Sbjct: 18 LVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILERLSEEPVSHF 77 Query: 445 ALILAPTRELAQQIQK 492 AL+L PT ELA QI + Sbjct: 78 ALVLTPTHELAYQISE 93 >U84552-1|AAC27683.1| 663|Drosophila melanogaster helicase pitchoune protein. Length = 663 Score = 53.2 bits (122), Expect = 3e-07 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 4/79 (5%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQID----T 426 E LR I GF + + IQ +++ P ++GRD++ AQ+G+GKT F I ++ I+ Sbjct: 179 EATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINKLRFM 238 Query: 427 SIRECQALILAPTRELAQQ 483 +I++PTREL+ Q Sbjct: 239 PRNGTGVIIISPTRELSMQ 257 >AY119620-1|AAM50274.1| 680|Drosophila melanogaster LD46167p protein. Length = 680 Score = 53.2 bits (122), Expect = 3e-07 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 4/79 (5%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQID----T 426 E LR I GF + + IQ +++ P ++GRD++ AQ+G+GKT F I ++ I+ Sbjct: 196 EATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINKLRFM 255 Query: 427 SIRECQALILAPTRELAQQ 483 +I++PTREL+ Q Sbjct: 256 PRNGTGVIIISPTRELSMQ 274 >AY089613-1|AAL90351.1| 798|Drosophila melanogaster RE28061p protein. Length = 798 Score = 53.2 bits (122), Expect = 3e-07 Identities = 37/91 (40%), Positives = 52/91 (57%), Gaps = 16/91 (17%) Frame = +1 Query: 262 ELLRGIYAYG-FEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI------ 420 E++R A ++KP+ +Q+ AI I GRD++A AQ+G+GKTA F + IL Q+ Sbjct: 304 EIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPILNQMYELGHV 363 Query: 421 --DTSIRECQ-------ALILAPTRELAQQI 486 S R+ L+LAPTRELA QI Sbjct: 364 PPPQSTRQYSRRKQYPLGLVLAPTRELATQI 394 >AY071402-1|AAL49024.1| 680|Drosophila melanogaster RE48840p protein. Length = 680 Score = 53.2 bits (122), Expect = 3e-07 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 4/79 (5%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQID----T 426 E LR I GF + + IQ +++ P ++GRD++ AQ+G+GKT F I ++ I+ Sbjct: 196 EATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINKLRFM 255 Query: 427 SIRECQALILAPTRELAQQ 483 +I++PTREL+ Q Sbjct: 256 PRNGTGVIIISPTRELSMQ 274 >AE014297-3091|AAN13900.2| 680|Drosophila melanogaster CG6375-PB, isoform B protein. Length = 680 Score = 53.2 bits (122), Expect = 3e-07 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 4/79 (5%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQID----T 426 E LR I GF + + IQ +++ P ++GRD++ AQ+G+GKT F I ++ I+ Sbjct: 196 EATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINKLRFM 255 Query: 427 SIRECQALILAPTRELAQQ 483 +I++PTREL+ Q Sbjct: 256 PRNGTGVIIISPTRELSMQ 274 >AE014297-3090|AAF55951.2| 680|Drosophila melanogaster CG6375-PA, isoform A protein. Length = 680 Score = 53.2 bits (122), Expect = 3e-07 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 4/79 (5%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQID----T 426 E LR I GF + + IQ +++ P ++GRD++ AQ+G+GKT F I ++ I+ Sbjct: 196 EATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINKLRFM 255 Query: 427 SIRECQALILAPTRELAQQ 483 +I++PTREL+ Q Sbjct: 256 PRNGTGVIIISPTRELSMQ 274 >AE014297-778|AAF54262.1| 798|Drosophila melanogaster CG9748-PA protein. Length = 798 Score = 53.2 bits (122), Expect = 3e-07 Identities = 37/91 (40%), Positives = 52/91 (57%), Gaps = 16/91 (17%) Frame = +1 Query: 262 ELLRGIYAYG-FEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI------ 420 E++R A ++KP+ +Q+ AI I GRD++A AQ+G+GKTA F + IL Q+ Sbjct: 304 EIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPILNQMYELGHV 363 Query: 421 --DTSIRECQ-------ALILAPTRELAQQI 486 S R+ L+LAPTRELA QI Sbjct: 364 PPPQSTRQYSRRKQYPLGLVLAPTRELATQI 394 >AY051513-1|AAK92937.1| 613|Drosophila melanogaster GH16590p protein. Length = 613 Score = 52.4 bits (120), Expect = 4e-07 Identities = 28/87 (32%), Positives = 54/87 (62%), Gaps = 7/87 (8%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQ-------Q 417 + +L+ + ++GF++ + +Q AI + +DV A+A +G+GKT F + +L+ + Sbjct: 16 DAVLQVVQSFGFQQMTPVQTAAIPLLLARKDVSAEAVTGSGKTLAFLVPMLEILQRRHKE 75 Query: 418 IDTSIRECQALILAPTRELAQQIQKVV 498 +E AL+++PTRELA+QI +V+ Sbjct: 76 TPWGPKEIGALVISPTRELARQISEVL 102 >AE014297-721|AAF54208.1| 613|Drosophila melanogaster CG9630-PA protein. Length = 613 Score = 52.4 bits (120), Expect = 4e-07 Identities = 28/87 (32%), Positives = 54/87 (62%), Gaps = 7/87 (8%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQ-------Q 417 + +L+ + ++GF++ + +Q AI + +DV A+A +G+GKT F + +L+ + Sbjct: 16 DAVLQVVQSFGFQQMTPVQTAAIPLLLARKDVSAEAVTGSGKTLAFLVPMLEILQRRHKE 75 Query: 418 IDTSIRECQALILAPTRELAQQIQKVV 498 +E AL+++PTRELA+QI +V+ Sbjct: 76 TPWGPKEIGALVISPTRELARQISEVL 102 >AE014296-2963|AAF49303.1| 594|Drosophila melanogaster CG5589-PA protein. Length = 594 Score = 52.4 bits (120), Expect = 4e-07 Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 1/77 (1%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT-SIREC 441 L + + + F+ P+ IQ +A+ +Q R ++A A +G+GKT F I+ + Sbjct: 130 LQQNLLSRNFDHPTPIQMQALPVLLQRRALMACAPTGSGKTLAFLTPIINGLRAHKTTGL 189 Query: 442 QALILAPTRELAQQIQK 492 +AL+LAPTRELAQQI + Sbjct: 190 RALVLAPTRELAQQIYR 206 >AE014134-2564|AAF53438.1| 661|Drosophila melanogaster CG3506-PA protein. Length = 661 Score = 52.4 bits (120), Expect = 4e-07 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 5/82 (6%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI----- 420 ++ ++ + G++ P+ IQ+ +I GRD++A AQ+G+GKTA F + IL ++ Sbjct: 253 RDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPH 312 Query: 421 DTSIRECQALILAPTRELAQQI 486 + + Q +I++PTRELA QI Sbjct: 313 ELELGRPQVVIVSPTRELAIQI 334 >AY061400-1|AAL28948.1| 791|Drosophila melanogaster LD32732p protein. Length = 791 Score = 52.0 bits (119), Expect = 6e-07 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 5/81 (6%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI--DTSI 432 E+L++ + + +P+ IQ +A+ + GRD+I A++G+GKTA F +L + + Sbjct: 278 EQLIKAVRKAEYTQPTPIQAQAVPTALSGRDIIGIAKTGSGKTAAFIWPMLMHVMDQKQL 337 Query: 433 RECQ---ALILAPTRELAQQI 486 + LILAPTREL+ QI Sbjct: 338 KPGDGPIGLILAPTRELSLQI 358 >AE014296-1853|AAF50131.1| 791|Drosophila melanogaster CG6418-PB protein. Length = 791 Score = 52.0 bits (119), Expect = 6e-07 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 5/81 (6%) Frame = +1 Query: 259 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI--DTSI 432 E+L++ + + +P+ IQ +A+ + GRD+I A++G+GKTA F +L + + Sbjct: 278 EQLIKAVRKAEYTQPTPIQAQAVPTALSGRDIIGIAKTGSGKTAAFIWPMLMHVMDQKQL 337 Query: 433 RECQ---ALILAPTRELAQQI 486 + LILAPTREL+ QI Sbjct: 338 KPGDGPIGLILAPTRELSLQI 358 >M23560-1|AAA29013.1| 648|Drosophila melanogaster protein ( D.melanogaster antigenMab46F11 (vasa) mRNA, complete cds. ). Length = 648 Score = 51.6 bits (118), Expect = 8e-07 Identities = 29/82 (35%), Positives = 50/82 (60%), Gaps = 5/82 (6%) Frame = +1 Query: 256 KEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI----- 420 ++ ++ + G++ P+ IQ+ +I GRD++A AQ+G+GKTA F + IL ++ Sbjct: 240 RDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPH 299 Query: 421 DTSIRECQALILAPTRELAQQI 486 + + Q I++PTRELA QI Sbjct: 300 ELELGRPQVCIVSPTRELAIQI 321 >AY119628-1|AAM50282.1| 826|Drosophila melanogaster RE19835p protein. Length = 826 Score = 51.2 bits (117), Expect = 1e-06 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = +1 Query: 292 FEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQID----TSIRECQALILA 459 F P+ +Q+ +I P +QG+DV+ A +G+GKT F I +L+ + + A+I++ Sbjct: 92 FVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHLFMNKWSRTDGVGAIIIS 151 Query: 460 PTRELAQQI 486 PTRELA QI Sbjct: 152 PTRELAYQI 160 >AE014298-2591|AAF48747.2| 826|Drosophila melanogaster CG5800-PA protein. Length = 826 Score = 51.2 bits (117), Expect = 1e-06 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = +1 Query: 292 FEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQID----TSIRECQALILA 459 F P+ +Q+ +I P +QG+DV+ A +G+GKT F I +L+ + + A+I++ Sbjct: 92 FVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHLFMNKWSRTDGVGAIIIS 151 Query: 460 PTRELAQQI 486 PTRELA QI Sbjct: 152 PTRELAYQI 160 >BT004908-1|AAO49161.1| 782|Drosophila melanogaster LD15481p protein. Length = 782 Score = 49.2 bits (112), Expect = 4e-06 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 4/81 (4%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI----DTSI 432 L+R I G+ P+ IQ I + GRD+ A +GTGKTA + + L+++ + Sbjct: 168 LMRAIGVLGYIYPTPIQASTIPVALLGRDICGCAATGTGKTAAYMLPTLERLLYRPLNNK 227 Query: 433 RECQALILAPTRELAQQIQKV 495 + L+L PTREL Q+ +V Sbjct: 228 AITRVLVLVPTRELGAQVYQV 248 >AF181659-1|AAD55444.1| 641|Drosophila melanogaster BcDNA.GM05306 protein. Length = 641 Score = 49.2 bits (112), Expect = 4e-06 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 4/81 (4%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI----DTSI 432 L+R I G+ P+ IQ I + GRD+ A +GTGKTA + + L+++ + Sbjct: 168 LMRAIGVLGYIYPTPIQASTIPVALLGRDICGCAATGTGKTAAYMLPTLERLLYRPLNNK 227 Query: 433 RECQALILAPTRELAQQIQKV 495 + L+L PTREL Q+ +V Sbjct: 228 AITRVLVLVPTRELGAQVYQV 248 >AF145609-1|AAD38584.1| 974|Drosophila melanogaster BcDNA.GH02833 protein. Length = 974 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/75 (30%), Positives = 46/75 (61%), Gaps = 6/75 (8%) Frame = +1 Query: 304 SAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ------ALILAPT 465 +++QQ+ I +QG+DV+ ++Q+G+GKT +++ +++ + Q AL++ PT Sbjct: 351 TSVQQKTIPEVLQGKDVLVRSQTGSGKTLAYALPLVELLQKQQPRIQRKDGVLALVIVPT 410 Query: 466 RELAQQIQKVVIALV 510 REL Q +++ LV Sbjct: 411 RELVMQTYELIQKLV 425 >AE014298-2568|AAO41693.1| 975|Drosophila melanogaster CG8611-PB, isoform B protein. Length = 975 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/75 (30%), Positives = 46/75 (61%), Gaps = 6/75 (8%) Frame = +1 Query: 304 SAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ------ALILAPT 465 +++QQ+ I +QG+DV+ ++Q+G+GKT +++ +++ + Q AL++ PT Sbjct: 352 TSVQQKTIPEVLQGKDVLVRSQTGSGKTLAYALPLVELLQKQQPRIQRKDGVLALVIVPT 411 Query: 466 RELAQQIQKVVIALV 510 REL Q +++ LV Sbjct: 412 RELVMQTYELIQKLV 426 >AE014298-2567|AAF48727.2| 974|Drosophila melanogaster CG8611-PA, isoform A protein. Length = 974 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/75 (30%), Positives = 46/75 (61%), Gaps = 6/75 (8%) Frame = +1 Query: 304 SAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ------ALILAPT 465 +++QQ+ I +QG+DV+ ++Q+G+GKT +++ +++ + Q AL++ PT Sbjct: 351 TSVQQKTIPEVLQGKDVLVRSQTGSGKTLAYALPLVELLQKQQPRIQRKDGVLALVIVPT 410 Query: 466 RELAQQIQKVVIALV 510 REL Q +++ LV Sbjct: 411 RELVMQTYELIQKLV 425 >AE013599-611|AAF59119.1| 782|Drosophila melanogaster CG2173-PA protein. Length = 782 Score = 49.2 bits (112), Expect = 4e-06 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 4/81 (4%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQI----DTSI 432 L+R I G+ P+ IQ I + GRD+ A +GTGKTA + + L+++ + Sbjct: 168 LMRAIGVLGYIYPTPIQASTIPVALLGRDICGCAATGTGKTAAYMLPTLERLLYRPLNNK 227 Query: 433 RECQALILAPTRELAQQIQKV 495 + L+L PTREL Q+ +V Sbjct: 228 AITRVLVLVPTRELGAQVYQV 248 >X52846-1|CAA37037.1| 575|Drosophila melanogaster protein ( Drosophila melanogasterRM62 mRNA for novel RNA helicase. ). Length = 575 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Frame = +1 Query: 247 HEPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT 426 H P + +++ I G++ P+AIQ + + G + + A++G+GKT + + + I+ Sbjct: 143 HLP-DYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN 201 Query: 427 SIRECQ------ALILAPTRELAQQIQKV 495 + Q AL+LAPTRELAQQIQ+V Sbjct: 202 Q-QPLQRGDGPIALVLAPTRELAQQIQQV 229 >BT015209-1|AAT94438.1| 575|Drosophila melanogaster RE56857p protein. Length = 575 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Frame = +1 Query: 247 HEPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT 426 H P + +++ I G++ P+AIQ + + G + + A++G+GKT + + + I+ Sbjct: 143 HLP-DYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN 201 Query: 427 SIRECQ------ALILAPTRELAQQIQKV 495 + Q AL+LAPTRELAQQIQ+V Sbjct: 202 Q-QPLQRGDGPIALVLAPTRELAQQIQQV 229 >BT011476-1|AAR99134.1| 719|Drosophila melanogaster RE11923p protein. Length = 719 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Frame = +1 Query: 247 HEPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT 426 H P + +++ I G++ P+AIQ + + G + + A++G+GKT + + + I+ Sbjct: 287 HLP-DYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN 345 Query: 427 SIRECQ------ALILAPTRELAQQIQKV 495 + Q AL+LAPTRELAQQIQ+V Sbjct: 346 Q-QPLQRGDGPIALVLAPTRELAQQIQQV 373 >BT001716-1|AAN71471.1| 578|Drosophila melanogaster RE68337p protein. Length = 578 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Frame = +1 Query: 247 HEPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT 426 H P + +++ I G++ P+AIQ + + G + + A++G+GKT + + + I+ Sbjct: 146 HLP-DYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN 204 Query: 427 SIRECQ------ALILAPTRELAQQIQKV 495 + Q AL+LAPTRELAQQIQ+V Sbjct: 205 Q-QPLQRGDGPIALVLAPTRELAQQIQQV 232 >AE014297-394|AAG22212.1| 578|Drosophila melanogaster CG10279-PF, isoform F protein. Length = 578 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Frame = +1 Query: 247 HEPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT 426 H P + +++ I G++ P+AIQ + + G + + A++G+GKT + + + I+ Sbjct: 146 HLP-DYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN 204 Query: 427 SIRECQ------ALILAPTRELAQQIQKV 495 + Q AL+LAPTRELAQQIQ+V Sbjct: 205 Q-QPLQRGDGPIALVLAPTRELAQQIQQV 232 >AE014297-393|AAN14332.1| 578|Drosophila melanogaster CG10279-PC, isoform C protein. Length = 578 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Frame = +1 Query: 247 HEPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT 426 H P + +++ I G++ P+AIQ + + G + + A++G+GKT + + + I+ Sbjct: 146 HLP-DYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN 204 Query: 427 SIRECQ------ALILAPTRELAQQIQKV 495 + Q AL+LAPTRELAQQIQ+V Sbjct: 205 Q-QPLQRGDGPIALVLAPTRELAQQIQQV 232 >AE014297-392|AAF51926.2| 578|Drosophila melanogaster CG10279-PB, isoform B protein. Length = 578 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Frame = +1 Query: 247 HEPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT 426 H P + +++ I G++ P+AIQ + + G + + A++G+GKT + + + I+ Sbjct: 146 HLP-DYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN 204 Query: 427 SIRECQ------ALILAPTRELAQQIQKV 495 + Q AL+LAPTRELAQQIQ+V Sbjct: 205 Q-QPLQRGDGPIALVLAPTRELAQQIQQV 232 >AE014297-391|AAF51927.2| 578|Drosophila melanogaster CG10279-PE, isoform E protein. Length = 578 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Frame = +1 Query: 247 HEPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT 426 H P + +++ I G++ P+AIQ + + G + + A++G+GKT + + + I+ Sbjct: 146 HLP-DYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN 204 Query: 427 SIRECQ------ALILAPTRELAQQIQKV 495 + Q AL+LAPTRELAQQIQ+V Sbjct: 205 Q-QPLQRGDGPIALVLAPTRELAQQIQQV 232 >AE014297-390|AAN14331.1| 575|Drosophila melanogaster CG10279-PD, isoform D protein. Length = 575 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Frame = +1 Query: 247 HEPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT 426 H P + +++ I G++ P+AIQ + + G + + A++G+GKT + + + I+ Sbjct: 143 HLP-DYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN 201 Query: 427 SIRECQ------ALILAPTRELAQQIQKV 495 + Q AL+LAPTRELAQQIQ+V Sbjct: 202 Q-QPLQRGDGPIALVLAPTRELAQQIQQV 229 >AE014297-389|AAG22213.2| 719|Drosophila melanogaster CG10279-PA, isoform A protein. Length = 719 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Frame = +1 Query: 247 HEPKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDT 426 H P + +++ I G++ P+AIQ + + G + + A++G+GKT + + + I+ Sbjct: 287 HLP-DYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN 345 Query: 427 SIRECQ------ALILAPTRELAQQIQKV 495 + Q AL+LAPTRELAQQIQ+V Sbjct: 346 Q-QPLQRGDGPIALVLAPTRELAQQIQQV 373 >AY051752-1|AAK93176.1| 619|Drosophila melanogaster LD28839p protein. Length = 619 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 8/86 (9%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISIL-----QQIDTS 429 +L G+ A G + P+ IQ + + + GRD+I A +G+GKT F + ++ Q+ Sbjct: 188 ILNGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGKTLVFVLPVIMFALEQEYSLP 247 Query: 430 IRECQ---ALILAPTRELAQQIQKVV 498 + LI+ P+RELA+Q +++ Sbjct: 248 FERNEGPYGLIICPSRELAKQTHEII 273 >AF212866-1|AAF19985.1| 619|Drosophila melanogaster abstrakt protein protein. Length = 619 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 8/86 (9%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISIL-----QQIDTS 429 +L G+ A G + P+ IQ + + + GRD+I A +G+GKT F + ++ Q+ Sbjct: 188 ILNGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGKTLVFVLPVIMFALEQEYSLP 247 Query: 430 IRECQ---ALILAPTRELAQQIQKVV 498 + LI+ P+RELA+Q +++ Sbjct: 248 FERNEGPYGLIICPSRELAKQTHEII 273 >AF187729-1|AAF04040.1| 614|Drosophila melanogaster DEAD-box protein abstrakt protein. Length = 614 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 8/86 (9%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISIL-----QQIDTS 429 +L G+ A G + P+ IQ + + + GRD+I A +G+GKT F + ++ Q+ Sbjct: 183 ILNGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGKTLVFVLPVIMFALEQEYSLP 242 Query: 430 IRECQ---ALILAPTRELAQQIQKVV 498 + LI+ P+RELA+Q +++ Sbjct: 243 FERNEGPYGLIICPSRELAKQTHEII 268 >AE014297-15|AAF52165.1| 619|Drosophila melanogaster CG14637-PA protein. Length = 619 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 8/86 (9%) Frame = +1 Query: 265 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISIL-----QQIDTS 429 +L G+ A G + P+ IQ + + + GRD+I A +G+GKT F + ++ Q+ Sbjct: 188 ILNGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGKTLVFVLPVIMFALEQEYSLP 247 Query: 430 IRECQ---ALILAPTRELAQQIQKVV 498 + LI+ P+RELA+Q +++ Sbjct: 248 FERNEGPYGLIICPSRELAKQTHEII 273 >M74824-1|AAC14192.1| 644|Drosophila melanogaster D-E-A-D box protein protein. Length = 644 Score = 44.8 bits (101), Expect = 9e-05 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 1/70 (1%) Frame = +1 Query: 301 PSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR-ECQALILAPTRELA 477 P ++ A P + RD+ A +G+GKT F+I I+Q + + + +AL++ P ELA Sbjct: 169 PWILEAHAKPPPFRPRDICVSAPTGSGKTLAFAIPIVQLLSQRVDCKVRALVVLPVAELA 228 Query: 478 QQIQKVVIAL 507 Q+ +V+ L Sbjct: 229 LQVYRVISEL 238 >BT010045-1|AAQ22514.1| 687|Drosophila melanogaster LD27814p protein. Length = 687 Score = 44.8 bits (101), Expect = 9e-05 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 1/70 (1%) Frame = +1 Query: 301 PSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR-ECQALILAPTRELA 477 P ++ A P + RD+ A +G+GKT F+I I+Q + + + +AL++ P ELA Sbjct: 169 PWILEAHAKPPPFRPRDICVSAPTGSGKTLAFAIPIVQLLSQRVDCKVRALVVLPVAELA 228 Query: 478 QQIQKVVIAL 507 Q+ +V+ L Sbjct: 229 LQVYRVISEL 238 >AF132173-1|AAD34761.1| 687|Drosophila melanogaster unknown protein. Length = 687 Score = 44.8 bits (101), Expect = 9e-05 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 1/70 (1%) Frame = +1 Query: 301 PSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR-ECQALILAPTRELA 477 P ++ A P + RD+ A +G+GKT F+I I+Q + + + +AL++ P ELA Sbjct: 169 PWILEAHAKPPPFRPRDICVSAPTGSGKTLAFAIPIVQLLSQRVDCKVRALVVLPVAELA 228 Query: 478 QQIQKVVIAL 507 Q+ +V+ L Sbjct: 229 LQVYRVISEL 238 >AE014296-2792|AAF49419.1| 687|Drosophila melanogaster CG9680-PA protein. Length = 687 Score = 44.8 bits (101), Expect = 9e-05 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 1/70 (1%) Frame = +1 Query: 301 PSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIR-ECQALILAPTRELA 477 P ++ A P + RD+ A +G+GKT F+I I+Q + + + +AL++ P ELA Sbjct: 169 PWILEAHAKPPPFRPRDICVSAPTGSGKTLAFAIPIVQLLSQRVDCKVRALVVLPVAELA 228 Query: 478 QQIQKVVIAL 507 Q+ +V+ L Sbjct: 229 LQVYRVISEL 238 >AY058515-1|AAL13744.1| 680|Drosophila melanogaster LD21880p protein. Length = 680 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 5/57 (8%) Frame = +1 Query: 337 IQGRDVIAQAQSGTGKTATFSISILQQI-DTSIRE----CQALILAPTRELAQQIQK 492 + GRD+I A++G+GKT F + + + I D E A+I+APTREL QI K Sbjct: 1 MSGRDLIGIAKTGSGKTLAFILPMFRHILDQPSMEDGDGAIAIIMAPTRELCMQIGK 57 >U34773-1|AAC47309.1| 725|Drosophila melanogaster DEAD-box protein protein. Length = 725 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = +1 Query: 301 PSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 P+ +Q AI + G DV+ A++G+GKT F + ILQ + ++R+ + Sbjct: 25 PTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPILQIVWETLRDLE 72 >AY119661-1|AAM50315.1| 727|Drosophila melanogaster SD05527p protein. Length = 727 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = +1 Query: 301 PSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 P+ +Q AI + G DV+ A++G+GKT F + ILQ + ++R+ + Sbjct: 25 PTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPILQIVWETLRDLE 72 >AE014296-3658|AAF51814.1| 727|Drosophila melanogaster CG9054-PA protein. Length = 727 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = +1 Query: 301 PSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ 444 P+ +Q AI + G DV+ A++G+GKT F + ILQ + ++R+ + Sbjct: 25 PTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPILQIVWETLRDLE 72 >AY084126-1|AAL89864.1| 376|Drosophila melanogaster RE20606p protein. Length = 376 Score = 37.1 bits (82), Expect = 0.018 Identities = 21/49 (42%), Positives = 32/49 (65%), Gaps = 5/49 (10%) Frame = +1 Query: 355 IAQAQSGTGKTATFSISILQQI-----DTSIRECQALILAPTRELAQQI 486 +A AQ+G+GKTA F + IL ++ + + Q +I++PTRELA QI Sbjct: 1 MACAQTGSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQI 49 >AF239691-1|AAF85950.1| 108|Drosophila melanogaster unknown protein. Length = 108 Score = 35.9 bits (79), Expect = 0.042 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +1 Query: 322 AIMPCIQGRDVIAQAQSGTGKTATFSISILQQI 420 AI I GRD++A AQ+G+GKT F + IL Q+ Sbjct: 3 AIPIIINGRDLMACAQTGSGKTTAFLVPILNQM 35 >AY058512-1|AAL13741.1| 536|Drosophila melanogaster LD21669p protein. Length = 536 Score = 34.7 bits (76), Expect = 0.096 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 8/77 (10%) Frame = +1 Query: 289 GFEKPSAIQQRAIMPCIQGRD-VIAQAQSGTGKTATFSISILQQI-------DTSIRECQ 444 G + + IQ++ MP + G + + A++G GKT T+ + I+ ++ + + + Sbjct: 128 GIKLLTGIQKQG-MPVVHGNEHCLIAAETGCGKTITYLLPIVDKLLQKEVVTERKLNTPR 186 Query: 445 ALILAPTRELAQQIQKV 495 LIL P RELA QI V Sbjct: 187 VLILTPGRELATQIAGV 203 >AE014134-152|AAF51458.1| 536|Drosophila melanogaster CG3561-PA protein. Length = 536 Score = 34.7 bits (76), Expect = 0.096 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 8/77 (10%) Frame = +1 Query: 289 GFEKPSAIQQRAIMPCIQGRD-VIAQAQSGTGKTATFSISILQQI-------DTSIRECQ 444 G + + IQ++ MP + G + + A++G GKT T+ + I+ ++ + + + Sbjct: 128 GIKLLTGIQKQG-MPVVHGNEHCLIAAETGCGKTITYLLPIVDKLLQKEVVTERKLNTPR 186 Query: 445 ALILAPTRELAQQIQKV 495 LIL P RELA QI V Sbjct: 187 VLILTPGRELATQIAGV 203 >AE014298-1416|AAF46559.1| 1161|Drosophila melanogaster CG15311-PA protein. Length = 1161 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H H G++L H H HG H+ H +HH Sbjct: 713 HHHHHHSGQHLGNHHHHSHHHGYNHNGAHNHHHH 746 >AE014298-2611|AAF48765.3| 1039|Drosophila melanogaster CG8146-PA protein. Length = 1039 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 Query: 582 SPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 SP+G H H+ H HG H S H +HH Sbjct: 395 SPLGHTSHCHYHHSHGHG--HGSHHHHHHH 422 >AE014296-1744|AAF50205.1| 154|Drosophila melanogaster CG14173-PA protein. Length = 154 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = +3 Query: 453 PGSHKRAGPTNSEGGDSSCDH----LNAKCHACIGGTNVREDIRQ 575 PG+HK GP S+ D C H L K + +G ++ ED Q Sbjct: 43 PGNHKLCGPALSDAMDVVCPHGFNTLPRKRESLLGNSDDDEDTEQ 87 >DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDXDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDXDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDXDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDXDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDRDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 >DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 594 HEHQSPVGEYLHGHWCHQCKHGI*HSSDHKSYHH 493 H+H G + HGH H H H DH +HH Sbjct: 68 HDHDHDHGHHHHGH-DHDHDHD--HGHDHGHHHH 98 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,797,423 Number of Sequences: 53049 Number of extensions: 718633 Number of successful extensions: 3101 Number of sequences better than 10.0: 266 Number of HSP's better than 10.0 without gapping: 2271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2709 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2420893683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -