BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00640 (618 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64857-15|AAC25858.1| 470|Caenorhabditis elegans Hypothetical p... 29 2.0 AF016441-8|AAB65913.2| 212|Caenorhabditis elegans Hypothetical ... 28 6.1 >U64857-15|AAC25858.1| 470|Caenorhabditis elegans Hypothetical protein C37C3.1 protein. Length = 470 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 482 PGRPRPVRLQRSLHARRAVSLNWSASSRYTIAQSSTST 595 P R RPVR RS R + NW+ + T +Q+ +S+ Sbjct: 354 PPRKRPVRRSRSRSRSRTPNRNWTRARSRTRSQAKSSS 391 >AF016441-8|AAB65913.2| 212|Caenorhabditis elegans Hypothetical protein M03F8.6 protein. Length = 212 Score = 27.9 bits (59), Expect = 6.1 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -2 Query: 233 ELLIRRPGHNLVWDDPLVRPPRYSALRCPPERVRQQTLVMFGFV-IFHNNVQFETFLT 63 +L+I R H++ W+D + +YSA P+R RQ+ + + I + V FE T Sbjct: 22 DLIIERRPHHVDWEDLFMEYNKYSA----PDRSRQEVNLTLEIIDISFHRVLFELVQT 75 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,213,632 Number of Sequences: 27780 Number of extensions: 226416 Number of successful extensions: 638 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -