BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00639 (727 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 68 9e-12 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 3.5 SB_49681| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_44015| Best HMM Match : TPR_2 (HMM E-Value=7.3e-07) 29 3.8 SB_7904| Best HMM Match : F420_oxidored (HMM E-Value=9.94922e-44) 29 3.8 SB_56714| Best HMM Match : 7tm_3 (HMM E-Value=1.6e-18) 28 8.9 SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) 28 8.9 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 67.7 bits (158), Expect = 9e-12 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +3 Query: 381 DFNDMFLDPEIMAAFQDPEISAAFKDVTSNPANFIKYQNNPKM 509 D N + DPE+M AFQDPE+ AAF+DV NPAN KYQNNPK+ Sbjct: 228 DINTILNDPEVMQAFQDPEVMAAFQDVNQNPANMAKYQNNPKI 270 Score = 63.7 bits (148), Expect = 1e-10 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = +1 Query: 31 YKFRGRAYRLLGKFEESSHDLCESLKIDYDDQTNEWLNEVKPNAEKLRQHK 183 YK+RGRA+ LG +E++ DL ++LK+D+D+Q NEW +V P EK R+ K Sbjct: 119 YKWRGRAHEFLGHWEKADKDLAQALKLDFDEQVNEWFKDVHPKEEKERKRK 169 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 25.4 bits (53), Expect(2) = 3.5 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 268 LLRPKPMLQLVQHPGISPASLEA 336 L +P+ LQ ++HPGI+ A A Sbjct: 77 LTQPEDALQYIKHPGITEAQSSA 99 Score = 22.2 bits (45), Expect(2) = 3.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 115 YDDQTNEWLNEVKPN 159 + +Q EWL V+PN Sbjct: 36 WPEQAMEWLERVRPN 50 >SB_49681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 250 QEQEHVLLRPKPMLQLVQH-PGISPASL 330 QE+E LL+P+P L V PG++PA L Sbjct: 14 QEEEKRLLQPEPKLMTVSDTPGVTPACL 41 >SB_44015| Best HMM Match : TPR_2 (HMM E-Value=7.3e-07) Length = 635 Score = 29.1 bits (62), Expect = 3.8 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 1/78 (1%) Frame = +2 Query: 107 RLTMMIKQMSGLMKLNQMLKNYVNTN*VPNVKKRRKSIERNYAEPVKHRSKSTCCSGPSQ 286 RL +MIK M + + + N N+ +K + + +NY + VK + CS PS Sbjct: 184 RLNIMIKSMKACKREIKSVLNTGNSTVGLFLKSNFEYLRQNYRKSVKLLNSVQKCSNPSL 243 Query: 287 CCSWC-NTRGFPRLPWRH 337 C NT F L H Sbjct: 244 ETGQCINTMYFNNLGCIH 261 >SB_7904| Best HMM Match : F420_oxidored (HMM E-Value=9.94922e-44) Length = 851 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 458 IFECCRYFRILECCHNFWIKEHVIEVIQIY-TSRHTTRDIRHAS 330 +F+ CR IL+ +NF + E +E + Y +S+ D+R+ S Sbjct: 195 VFKSCRKLEILDLSYNFNLNEDCLETLAQYSSSKLRYLDLRNCS 238 >SB_56714| Best HMM Match : 7tm_3 (HMM E-Value=1.6e-18) Length = 484 Score = 27.9 bits (59), Expect = 8.9 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 217 ALSPLFYVGHLICVDVIF 164 AL PL YVG+ +C+ V+F Sbjct: 222 ALPPLRYVGYSVCISVLF 239 >SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) Length = 937 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +1 Query: 382 TSMTCSLIQKLWQHSRILKYLQHSKMLQVIQQI 480 T + S +QKL++ RI+K+L H ++++ + I Sbjct: 117 TQLNPSSLQKLFREVRIMKFLDHPNIVKLYEVI 149 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,424,789 Number of Sequences: 59808 Number of extensions: 351637 Number of successful extensions: 1006 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1005 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -