BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00636 (498 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_26429| Best HMM Match : Autophagy_N (HMM E-Value=2.8) 29 2.1 >SB_24939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 868 Score = 29.5 bits (63), Expect = 1.6 Identities = 22/75 (29%), Positives = 27/75 (36%) Frame = -3 Query: 385 HATLRDVWTYATXXXXXXXXXXVSHFIHKYYNIRNFESQNIQ**HIKHGGTTHAHTR*EN 206 H L W A H + +YY +SQNIQ H K G Sbjct: 585 HPELLQTWRRAGPFEYGNRLQDSPHLVRRYYLFAGDDSQNIQ-VHFKSGFPVVTVPLPSR 643 Query: 205 *NVCEFFFRSPLSRS 161 +C+F R PLS S Sbjct: 644 RELCQFTLR-PLSES 657 >SB_26429| Best HMM Match : Autophagy_N (HMM E-Value=2.8) Length = 219 Score = 29.1 bits (62), Expect = 2.1 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = -1 Query: 495 FLSKKKQ*INKM-YFMLIYETVNDDERDTSERSRKNARTRLSVT-FGRTRRFDVFAVCAR 322 F K+ +N++ YF+L+Y + +D+R+ +E S R L+ FG + V A + Sbjct: 79 FRKTVKKFLNELIYFLLLYMQITEDQRNLAEHSTFCRRNMLANNEFGNRQNCLVPANAKK 138 Query: 321 AFRI 310 A RI Sbjct: 139 ASRI 142 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,550,859 Number of Sequences: 59808 Number of extensions: 158630 Number of successful extensions: 415 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -