BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00629 (669 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 27 0.16 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 8.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 8.0 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 27.1 bits (57), Expect = 0.16 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 391 FVDRNAYVWTQGDDGKWATTLVLLRINRAATCVKWSPMETSLLSG 525 F+D + +W +DGK L+ + V++SPME + L G Sbjct: 3 FID-DELLWCPDNDGKMVDLTQCLQESSTGQSVEFSPMELNALVG 46 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 8.0 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 465 YQPSSDLREMVSHGDKF-AVGSGARLISI 548 +QP ++R V+ GDK GS A SI Sbjct: 765 FQPDKNIRRKVTMGDKSKKQGSSAGTSSI 793 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 8.0 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 465 YQPSSDLREMVSHGDKF-AVGSGARLISI 548 +QP ++R V+ GDK GS A SI Sbjct: 855 FQPDKNIRRKVTMGDKSKKQGSSAGTSSI 883 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,253 Number of Sequences: 438 Number of extensions: 4364 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -