BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00620 (631 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|... 32 0.079 SPCC188.03 |cnd3||condensin subunit Cnd3 |Schizosaccharomyces po... 29 0.42 SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pom... 27 1.7 SPAC767.01c |vps1|SPAC9G1.14c|dynamin family protein Vps1|Schizo... 26 3.9 SPCC4G3.09c |gyp3||GTPase activating protein Gyp3|Schizosaccharo... 26 5.2 SPBC1348.02 |||S. pombe specific 5Tm protein family|Schizosaccha... 25 6.8 SPAC16A10.08c |mug74|SPAC589.01c|sequence orphan|Schizosaccharom... 25 6.8 SPBPB2B2.19c |||S. pombe specific 5Tm protein family|Schizosacch... 25 6.8 SPAC977.01 |||S. pombe specific 5Tm protein family|Schizosacchar... 25 6.8 SPAC750.05c |||S. pombe specific 5Tm protein family|Schizosaccha... 25 6.8 SPAC7D4.06c |alg3||dolichol-P-Man dependent alpha|Schizosaccharo... 25 9.0 SPAC13G6.04 |tim8||TIM22 inner membrane protein import complex s... 25 9.0 >SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1469 Score = 31.9 bits (69), Expect = 0.079 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = -1 Query: 550 WRILTEDILCECIINSIPGWSGFSDFPIWSYISGSSC--SFATNSLLIFS 407 W++L +I + ++ S+P +S F+ F +++ I G + S A S+ +FS Sbjct: 513 WKLLLMEICIQVLVESLPVFSMFATFVVFTTIMGQTITPSIAFTSISLFS 562 >SPCC188.03 |cnd3||condensin subunit Cnd3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 875 Score = 29.5 bits (63), Expect = 0.42 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +1 Query: 97 LKIIEILKETEADTKNLFGRYGSQXMKDWQDVERNYEKE 213 L ++EI ++ + D L + +Q M DW D E+ YE++ Sbjct: 689 LSLLEIYRDLDEDDVQLSIGHIAQQMLDWTDNEKLYERK 727 >SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pombe|chr 1|||Manual Length = 986 Score = 27.5 bits (58), Expect = 1.7 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +1 Query: 49 DIAALLSGSYINYFH-CLKIIEILKETEADTKNLFGRYGSQXMKDWQDV 192 D +L I F CL++IEI KET+A+ +F Q + W D+ Sbjct: 187 DSMRMLQARGIKLFRSCLELIEIYKETKAEHVRVF---LEQILPPWMDM 232 >SPAC767.01c |vps1|SPAC9G1.14c|dynamin family protein Vps1|Schizosaccharomyces pombe|chr 1|||Manual Length = 678 Score = 26.2 bits (55), Expect = 3.9 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +3 Query: 294 KEEQAQADFEKKHADYLKNEASSKSEFLALCKQLGIQGEKIKRELVAKLQE 446 K E+ D + K +N +S EFL L Q + EKI+ E+V + +E Sbjct: 78 KNEETTTDSDGKD----QNNSSEWGEFLHLPGQKFFEFEKIREEIVRETEE 124 >SPCC4G3.09c |gyp3||GTPase activating protein Gyp3|Schizosaccharomyces pombe|chr 3|||Manual Length = 635 Score = 25.8 bits (54), Expect = 5.2 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 466 WSYISGSSCSFATNSLLIFSPWIPSCLHKARNSDLLD 356 W Y SG N L + W +C+ K +SDL++ Sbjct: 310 WFYYSGGYELLQRNPKLYETLWRCACIKKPSDSDLIE 346 >SPBC1348.02 |||S. pombe specific 5Tm protein family|Schizosaccharomyces pombe|chr 2|||Manual Length = 344 Score = 25.4 bits (53), Expect = 6.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 469 IWSYISGSSCSFATNSLLIFSPWIPSCLH 383 IW+YIS + LL S WI +CLH Sbjct: 95 IWNYISVAEMG---GVLLFLSYWIWTCLH 120 >SPAC16A10.08c |mug74|SPAC589.01c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 285 Score = 25.4 bits (53), Expect = 6.8 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 285 QIAKEEQAQADFEKKHADYLKNEASSKSEFLALCKQL 395 QI+++ + F K+ +K+E S E LCKQL Sbjct: 15 QISQQPETDLVFTKRSECKVKDELFSDKENSILCKQL 51 >SPBPB2B2.19c |||S. pombe specific 5Tm protein family|Schizosaccharomyces pombe|chr 2|||Manual Length = 344 Score = 25.4 bits (53), Expect = 6.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 469 IWSYISGSSCSFATNSLLIFSPWIPSCLH 383 IW+YIS + LL S WI +CLH Sbjct: 95 IWNYISVAEMG---GVLLFLSYWIWTCLH 120 >SPAC977.01 |||S. pombe specific 5Tm protein family|Schizosaccharomyces pombe|chr 1||Partial|Manual Length = 316 Score = 25.4 bits (53), Expect = 6.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 469 IWSYISGSSCSFATNSLLIFSPWIPSCLH 383 IW+YIS + LL S WI +CLH Sbjct: 67 IWNYISVAEMG---GVLLFLSYWIWTCLH 92 >SPAC750.05c |||S. pombe specific 5Tm protein family|Schizosaccharomyces pombe|chr 1|||Manual Length = 344 Score = 25.4 bits (53), Expect = 6.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 469 IWSYISGSSCSFATNSLLIFSPWIPSCLH 383 IW+YIS + LL S WI +CLH Sbjct: 95 IWNYISVAEMG---GVLLFLSYWIWTCLH 120 >SPAC7D4.06c |alg3||dolichol-P-Man dependent alpha|Schizosaccharomyces pombe|chr 1|||Manual Length = 406 Score = 25.0 bits (52), Expect = 9.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 518 MHYKLYTWLEWF**FPYL 465 +HY+ Y W W+ PYL Sbjct: 337 LHYQFYAWFAWY--SPYL 352 >SPAC13G6.04 |tim8||TIM22 inner membrane protein import complex subunit Tim8|Schizosaccharomyces pombe|chr 1|||Manual Length = 98 Score = 25.0 bits (52), Expect = 9.0 Identities = 10/30 (33%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +1 Query: 355 HQVNQSFW-LCVNNLVSKVRRSREN*WRNC 441 HQ + W C+ N+ +K+ +S E +NC Sbjct: 38 HQFTSTCWPKCIGNIGNKLDKSEEQCLQNC 67 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,388,183 Number of Sequences: 5004 Number of extensions: 46703 Number of successful extensions: 189 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 189 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -