BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00617 (542 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 27 0.40 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 2.8 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 23 4.9 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 6.5 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 6.5 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 6.5 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 6.5 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 8.6 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 27.1 bits (57), Expect = 0.40 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 510 AYFNDSQRQAT 542 AYFNDSQRQAT Sbjct: 8 AYFNDSQRQAT 18 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 2.8 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 72 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 173 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 23.4 bits (48), Expect = 4.9 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +3 Query: 186 SVLCCVHRHRASHRRCRQEPGGDNPNNTI 272 SVL C + R C P G N N ++ Sbjct: 10 SVLGCAYTQRTKCAACLDSPDGMNGNESL 38 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 480 NCAECSNHG 506 NCA C NHG Sbjct: 40 NCARCRNHG 48 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 480 NCAECSNHG 506 NCA C NHG Sbjct: 40 NCARCRNHG 48 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 480 NCAECSNHG 506 NCA C NHG Sbjct: 40 NCARCRNHG 48 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 480 NCAECSNHG 506 NCA C NHG Sbjct: 40 NCARCRNHG 48 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 8.6 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 122 QEYVVPRSIPTAGAFA 75 Q+Y PR++ +AG FA Sbjct: 1244 QDYAPPRALMSAGGFA 1259 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 623,058 Number of Sequences: 2352 Number of extensions: 14425 Number of successful extensions: 25 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50040333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -