BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00616 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47700| Best HMM Match : eIF_4EBP (HMM E-Value=3e-35) 79 4e-15 SB_43379| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_28433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_44745| Best HMM Match : zf-C2H2 (HMM E-Value=2.2e-05) 30 1.6 SB_15435| Best HMM Match : Fic (HMM E-Value=7.5) 30 1.6 SB_23460| Best HMM Match : 7tm_1 (HMM E-Value=0.44) 29 2.9 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_2014| Best HMM Match : MAM (HMM E-Value=0) 29 3.8 SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) 28 5.0 SB_25735| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_27282| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_435| Best HMM Match : zf-CCHC (HMM E-Value=2) 28 6.6 SB_5824| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_44796| Best HMM Match : Cornifin (HMM E-Value=1.7) 27 8.7 SB_34877| Best HMM Match : Methyltransf_2 (HMM E-Value=0.00017) 27 8.7 SB_19689| Best HMM Match : VWA (HMM E-Value=0.0035) 27 8.7 >SB_47700| Best HMM Match : eIF_4EBP (HMM E-Value=3e-35) Length = 148 Score = 78.6 bits (185), Expect = 4e-15 Identities = 35/63 (55%), Positives = 46/63 (73%) Frame = +3 Query: 78 MSASPIARQATHSQSIPSKRVLITDPAQMPDVYSSTPGGTIYSTTPGGTRIVYERSFMLP 257 M+ + R + +++IPS+RV + DP MP YS+TPGGTIYSTTPGGTRI+YER F+L Sbjct: 1 MNGTQAERGSPLARAIPSRRVPVHDPNHMPSDYSTTPGGTIYSTTPGGTRIIYERKFLLE 60 Query: 258 FGN 266 N Sbjct: 61 LRN 63 >SB_43379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3066 Score = 30.7 bits (66), Expect = 0.93 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 6/67 (8%) Frame = +3 Query: 123 IPSKRVLITDPAQMPDVYSSTPGGTIYSTTPGGTRIVY----ERSFMLPFGN--LRFPKR 284 +PS +++ P+ VYS P G I +P G +IVY E+ P G + P Sbjct: 1125 LPSSEIIVYSPSGEKIVYS--PSGEIIVYSPSGKKIVYSPSGEKIVYSPSGKKIVYLPSG 1182 Query: 285 HRNVHFP 305 +NV+ P Sbjct: 1183 EQNVYSP 1189 >SB_28433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 536 Score = 30.7 bits (66), Expect = 0.93 Identities = 23/66 (34%), Positives = 31/66 (46%) Frame = +3 Query: 156 AQMPDVYSSTPGGTIYSTTPGGTRIVYERSFMLPFGNLRFPKRHRNVHFPQPY*RIRLRY 335 + +P+V SS P G S+ P G+ + R + P FP R F PY R+ L Y Sbjct: 187 SSLPEVLSSLPEGL--SSLPEGS-LFPTRGSLFPNQGALFPTRG----FSLPYPRVSLPY 239 Query: 336 PTCSRP 353 P S P Sbjct: 240 PRVSLP 245 >SB_44745| Best HMM Match : zf-C2H2 (HMM E-Value=2.2e-05) Length = 572 Score = 29.9 bits (64), Expect = 1.6 Identities = 20/70 (28%), Positives = 31/70 (44%) Frame = +3 Query: 51 KLTPRKFLIMSASPIARQATHSQSIPSKRVLITDPAQMPDVYSSTPGGTIYSTTPGGTRI 230 ++T + + SAS T QS+P +T P Q+ + STP T+Y T G I Sbjct: 423 QVTGPQIKLPSASGSRHHPTTPQSLPVDMQQVTPP-QVNPITISTPSSTLYDCTYCGDNI 481 Query: 231 VYERSFMLPF 260 + + F Sbjct: 482 TLKSNLQRHF 491 >SB_15435| Best HMM Match : Fic (HMM E-Value=7.5) Length = 695 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 312 Y*RIRLRYPTCSRPAHKNLDLTRYHSTSRRKPS 410 Y ++RL YP+ S P K+ LT Y STS P+ Sbjct: 131 YRKVRLTYPSFSSPNGKDGGLTSYISTSFSPPN 163 >SB_23460| Best HMM Match : 7tm_1 (HMM E-Value=0.44) Length = 267 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = -2 Query: 513 KTSKRNIRKLAAQAVFDNNSFK 448 KT KR+I+K+ +++F NN+FK Sbjct: 151 KTPKRHIKKVNKKSLFSNNNFK 172 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 333 YPTCSRPAHKNLDLTRYHSTSRRKPSAWISKLVINFL 443 Y T P DLT +HS S R PS ++ ++V++ L Sbjct: 1410 YLTTPEPLGTISDLTVWHSDSGRSPSWYLRRIVVSDL 1446 >SB_2014| Best HMM Match : MAM (HMM E-Value=0) Length = 2282 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +2 Query: 182 HTGRNH--LLNYSWRYKNSVREVVHVTLRQS 268 ++GR+H LLNY W K+S ++ ++ LR S Sbjct: 2172 NSGRDHDNLLNYRWHQKDSFQQSMYRRLRDS 2202 >SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) Length = 1072 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/59 (25%), Positives = 25/59 (42%) Frame = +2 Query: 26 QVSCVEFCKINTTKVFNNVSVTYREAGHSQPIDSFKEGPDHGSRSNA*CLFQHTGRNHL 202 Q + ++ +I T +++ GH QP + F P H N +FQ +HL Sbjct: 246 QAAPPQYQQIQATHQPTQQQTFFQQQGHQQPGNIFDNPPFHPQSPNQPQIFQQQALHHL 304 >SB_25735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = -2 Query: 399 CDSSNDIELDRGFCVLAGCTLGTEDGFFSRAAGSAHCGGVW 277 C ++ + ++RG+ + + T + DG ++ +AG + G W Sbjct: 202 CTCASSLGVERGYILDSQMTSSSNDGAYTASAGRLYGGSSW 242 >SB_27282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 644 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +3 Query: 15 YPTNKCLVWNFVKLTPRKFLIMSASPIARQATHSQSIPSKRVLITDP 155 YP + WN+ L P L + A I + +H +SI + DP Sbjct: 244 YPNITNVHWNYTTLLPGDCLFLPAEYIHQVRSHIRSISVTMLFTVDP 290 >SB_435| Best HMM Match : zf-CCHC (HMM E-Value=2) Length = 913 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +3 Query: 126 PSKRVLITDPAQMPDVYSSTPGGTIYSTTPGGTRIVYERSFM 251 P+K VLI P + S+ P G I+ ++VY + M Sbjct: 410 PNKHVLIKRPVNISSAESTDPNGHIFVLCVSPVKLVYSQQEM 451 >SB_5824| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +3 Query: 459 YCQIRLARQACECFACSSFRRLWAVVKLARAKHNKKT 569 YC + ++ C C CSS+ +W V R +T Sbjct: 158 YCMV-VSLTVCLCIICSSYSAVWVRVHFKRPAQRTQT 193 >SB_44796| Best HMM Match : Cornifin (HMM E-Value=1.7) Length = 165 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 282 RHRNVHFPQPY*RIRLRYPTCSRPAHKNLDLTRYHSTS 395 +H N PQ ++ ++P H+N RYH+T+ Sbjct: 14 QHNNTAIPQHRTTKTPQHQNTAKPQHRNTTTPRYHNTA 51 >SB_34877| Best HMM Match : Methyltransf_2 (HMM E-Value=0.00017) Length = 893 Score = 27.5 bits (58), Expect = 8.7 Identities = 17/57 (29%), Positives = 21/57 (36%) Frame = +2 Query: 206 NYSWRYKNSVREVVHVTLRQSPISQTPPQCALPAALLKNPSSVPNVQPASTQKPRSN 376 NY Y+ S V R I + C L KN S+ P+V P R N Sbjct: 283 NYKAHYERSNVAAQLVGTRDDVIKREKEACKLQEGQNKNSSTCPSVSPEIQASERDN 339 >SB_19689| Best HMM Match : VWA (HMM E-Value=0.0035) Length = 885 Score = 27.5 bits (58), Expect = 8.7 Identities = 21/94 (22%), Positives = 38/94 (40%) Frame = +1 Query: 127 LQRGS*SRIPLKCLMSIPAHRAEPSTQLLLEVQE*CTRGRSCYPSAISDFPNATAMCTSR 306 L++G+ ++ L H A QL + E P+ + F + T +C S Sbjct: 327 LEKGAIKNAFIEELQEKKKHEALRVAQLYMSRDEQYDEYARVMPTGPNVFSSVTKICVSE 386 Query: 307 SPTEESVFGTQRAAGQHTKTSI*LDIIRRVAGNL 408 S +S + A +TKT+ D++ + L Sbjct: 387 SRATKSADRSLEAISSNTKTTHDQDLVNSSSSEL 420 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,529,510 Number of Sequences: 59808 Number of extensions: 425964 Number of successful extensions: 1027 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1023 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -