BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00616 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 24 0.98 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 2.3 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 23 2.3 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 23 2.3 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 4.0 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 22 4.0 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 4.0 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 4.0 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 5.3 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.3 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 5.3 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.3 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 6.9 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 6.9 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 6.9 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 6.9 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 6.9 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 6.9 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 6.9 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 24.2 bits (50), Expect = 0.98 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 530 SPQTSKRRASETFASLPRKPYLTITVLSIQKIND 429 +P+ + + F P Y +TVLSI IN+ Sbjct: 13 NPKLYDKHRAPKFLGQPTIVYFHVTVLSIDSINE 46 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.0 bits (47), Expect = 2.3 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -2 Query: 183 CWNRHQAFER 154 CWN HQ+ +R Sbjct: 327 CWNEHQSLDR 336 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 23.0 bits (47), Expect = 2.3 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -2 Query: 183 CWNRHQAFERD 151 CWN HQ +R+ Sbjct: 330 CWNEHQPLQRE 340 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 23.0 bits (47), Expect = 2.3 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -2 Query: 183 CWNRHQAFER 154 CWN HQ+ +R Sbjct: 327 CWNEHQSLQR 336 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.2 bits (45), Expect = 4.0 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -2 Query: 183 CWNRHQAFER 154 CWN H+ ER Sbjct: 329 CWNEHRTLER 338 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 22.2 bits (45), Expect = 4.0 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -2 Query: 183 CWNRHQAFER 154 CWN HQ +R Sbjct: 330 CWNEHQPLQR 339 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 4.0 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -2 Query: 183 CWNRHQAFER 154 CWN H+ ER Sbjct: 329 CWNEHRTLER 338 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 4.0 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -2 Query: 183 CWNRHQAFER 154 CWN H+ ER Sbjct: 329 CWNEHRTLER 338 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 494 FASLPRKPYLTITVLSIQKIND 429 FASL + PY L+ + +ND Sbjct: 466 FASLKKSPYFKEANLNTRMLND 487 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 141 LITDPAQMPDVYSSTPGGTIYSTTPG 218 ++TDP + P+VY G Y G Sbjct: 449 VLTDPKKNPNVYKVETVGDKYMAVSG 474 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 494 FASLPRKPYLTITVLSIQKIND 429 FASL + PY L+ + +ND Sbjct: 466 FASLKKSPYFKEANLNTRMLND 487 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 141 LITDPAQMPDVYSSTPGGTIYSTTPG 218 ++TDP + P+VY G Y G Sbjct: 449 VLTDPKKNPNVYKVETVGDKYMAVSG 474 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -2 Query: 495 IRKLAAQAVFDNNSFKYSEN 436 I L+ + + +NN++KY+ N Sbjct: 82 ISSLSNKTIHNNNNYKYNYN 101 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -2 Query: 495 IRKLAAQAVFDNNSFKYSEN 436 I L+ + + +NN++KY+ N Sbjct: 82 ISSLSNKTIHNNNNYKYNYN 101 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -2 Query: 495 IRKLAAQAVFDNNSFKYSEN 436 I L+ + + +NN++KY+ N Sbjct: 82 ISSLSNRTIHNNNNYKYNYN 101 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -2 Query: 495 IRKLAAQAVFDNNSFKYSEN 436 I L+ + + +NN++KY+ N Sbjct: 82 ISSLSNKTIHNNNNYKYNYN 101 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -2 Query: 495 IRKLAAQAVFDNNSFKYSEN 436 I L+ + + +NN++KY+ N Sbjct: 82 ISSLSNKTIHNNNNYKYNYN 101 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -2 Query: 495 IRKLAAQAVFDNNSFKYSEN 436 I L+ + + +NN++KY+ N Sbjct: 82 ISSLSNKTIHNNNNYKYNYN 101 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -2 Query: 495 IRKLAAQAVFDNNSFKYSEN 436 I L+ + + +NN++KY+ N Sbjct: 315 ISSLSNKTIHNNNNYKYNYN 334 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,749 Number of Sequences: 438 Number of extensions: 3335 Number of successful extensions: 20 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -