BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00611 (735 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 24 1.1 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 24 1.1 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 4.5 DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 22 5.9 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 5.9 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 594 KTNYENL*NYTNFEKGKKIPTKIHKNNN 677 K YE+L N + + GK++ KI N N Sbjct: 51 KIRYESLTNPSRLDSGKELYIKIIPNKN 78 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 278 RLFYCYYILLMFLVYTNI*IYS 213 +L+ Y +LMFL+YT IYS Sbjct: 29 KLYQKLYPVLMFLIYTITEIYS 50 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/32 (31%), Positives = 12/32 (37%) Frame = -2 Query: 680 HIIIFMNFCWDFFTFFKIRIISKIFVIRFFYK 585 HI F C DF + I+ R YK Sbjct: 73 HIFFFFAICCDFIALIVVNIVHVFRKRRVNYK 104 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +2 Query: 539 SKYHQRYGIQRLHLSICKKNELRKSLKL 622 SKY+ I + +CKK++ +K +++ Sbjct: 21 SKYNSILNIALKNFRLCKKHKTKKPVQI 48 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +2 Query: 539 SKYHQRYGIQRLHLSICKKNELRKSLKL 622 SKY+ I + +CKK++ +K +++ Sbjct: 21 SKYNSILNIALKNFRLCKKHKTKKPVQI 48 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 160 CPCRKYMY*MDRLIF 116 C C YM MDRL F Sbjct: 315 CLCELYMAFMDRLYF 329 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,404 Number of Sequences: 336 Number of extensions: 3407 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -