BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00608 (666 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 163 4e-42 L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 162 8e-42 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 162 8e-42 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 24 3.7 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 24 3.7 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 3.7 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 23 6.5 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 6.5 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 163 bits (396), Expect = 4e-42 Identities = 88/132 (66%), Positives = 95/132 (71%), Gaps = 1/132 (0%) Frame = +2 Query: 257 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNF 436 GISAAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN Sbjct: 18 GISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNL 77 Query: 437 ANVIRYFPTQALNFAFKDKYKQVF-SAVLTRRRILALLRW*SGLRWCRRSHLSVLRVPLD 613 ANVIRYFPTQALNFAFKD YKQVF V + G + PLD Sbjct: 78 ANVIRYFPTQALNFAFKDVYKQVFLGGVDKNTQFWRYFLGNLGSGGAAGATSLCFVYPLD 137 Query: 614 FARTRLAADVGK 649 FARTRL ADVG+ Sbjct: 138 FARTRLGADVGR 149 Score = 36.7 bits (81), Expect = 7e-04 Identities = 22/69 (31%), Positives = 40/69 (57%) Frame = +2 Query: 293 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 472 P + V+ + +Q S + ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SGRAKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 473 NFAFKDKYK 499 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 31.9 bits (69), Expect = 0.019 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 534 FWRYFXXXXXXXXXXXXTSLCFVYP 608 FWRYF TSLCFVYP Sbjct: 111 FWRYFLGNLGSGGAAGATSLCFVYP 135 Score = 26.2 bits (55), Expect = 0.93 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 207 MSNLADPVAFAKDFLA 254 M+ ADP FAKDFLA Sbjct: 1 MTKKADPYGFAKDFLA 16 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 162 bits (394), Expect = 8e-42 Identities = 88/131 (67%), Positives = 94/131 (71%), Gaps = 1/131 (0%) Frame = +2 Query: 257 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNF 436 GISAAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN Sbjct: 18 GISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNL 77 Query: 437 ANVIRYFPTQALNFAFKDKYKQVF-SAVLTRRRILALLRW*SGLRWCRRSHLSVLRVPLD 613 ANVIRYFPTQALNFAFKD YKQVF V + G + PLD Sbjct: 78 ANVIRYFPTQALNFAFKDVYKQVFLGGVDKNTQFWRYFLGNLGSGGAAGATSLCFVYPLD 137 Query: 614 FARTRLAADVG 646 FARTRL ADVG Sbjct: 138 FARTRLGADVG 148 Score = 35.5 bits (78), Expect = 0.002 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +2 Query: 293 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 472 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 473 NFAFKDKYK 499 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 31.9 bits (69), Expect = 0.019 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 534 FWRYFXXXXXXXXXXXXTSLCFVYP 608 FWRYF TSLCFVYP Sbjct: 111 FWRYFLGNLGSGGAAGATSLCFVYP 135 Score = 26.2 bits (55), Expect = 0.93 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 207 MSNLADPVAFAKDFLA 254 M+ ADP FAKDFLA Sbjct: 1 MTKKADPYGFAKDFLA 16 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 162 bits (394), Expect = 8e-42 Identities = 88/131 (67%), Positives = 94/131 (71%), Gaps = 1/131 (0%) Frame = +2 Query: 257 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNF 436 GISAAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN Sbjct: 18 GISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNL 77 Query: 437 ANVIRYFPTQALNFAFKDKYKQVF-SAVLTRRRILALLRW*SGLRWCRRSHLSVLRVPLD 613 ANVIRYFPTQALNFAFKD YKQVF V + G + PLD Sbjct: 78 ANVIRYFPTQALNFAFKDVYKQVFLGGVDKNTQFWRYFLGNLGSGGAAGATSLCFVYPLD 137 Query: 614 FARTRLAADVG 646 FARTRL ADVG Sbjct: 138 FARTRLGADVG 148 Score = 35.5 bits (78), Expect = 0.002 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +2 Query: 293 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 472 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 473 NFAFKDKYK 499 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 31.9 bits (69), Expect = 0.019 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 534 FWRYFXXXXXXXXXXXXTSLCFVYP 608 FWRYF TSLCFVYP Sbjct: 111 FWRYFLGNLGSGGAAGATSLCFVYP 135 Score = 26.2 bits (55), Expect = 0.93 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 207 MSNLADPVAFAKDFLA 254 M+ ADP FAKDFLA Sbjct: 1 MTKKADPYGFAKDFLA 16 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 24.2 bits (50), Expect = 3.7 Identities = 22/68 (32%), Positives = 29/68 (42%) Frame = +1 Query: 187 RSHNRTKCRTSPIRSRSLRTSWXXXXXXXXXXXXXXXXACQAAAPSTARQQADRRRPALQ 366 +S +R+K RTS RSRS RT + AA + A + RRR + Sbjct: 444 QSRSRSKTRTS--RSRS-RTPLPARGHVRARLTRRTIPPTRVAAAAAAPEGRRRRRAIAR 500 Query: 367 GYRRCLRP 390 RR RP Sbjct: 501 ARRRRCRP 508 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 482 FKDKYKQVFSAVLTRRRIL 538 F+D+Y+ F VL RRIL Sbjct: 588 FRDRYRSEFGFVLEGRRIL 606 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 482 FKDKYKQVFSAVLTRRRIL 538 F+D+Y+ F VL RRIL Sbjct: 632 FRDRYRSEFGFVLEGRRIL 650 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 39 EFQKRHTPTLCAPVITKLLQ 98 EFQ+R TP + +++K+ Q Sbjct: 350 EFQRRLTPAMIGELVSKMTQ 369 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.4 bits (48), Expect = 6.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 642 TSAARRVRAKSRGTRSTERWLRRHH 568 T AA V A+ + +RWLR HH Sbjct: 684 TPAAAAVVAEE-AVSAVDRWLREHH 707 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 655,358 Number of Sequences: 2352 Number of extensions: 12204 Number of successful extensions: 33 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -