BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00597 (751 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13560.1 68418.m01566 expressed protein weak similarity to SP... 33 0.27 At2g27170.1 68415.m06029 structural maintenance of chromosomes (... 32 0.47 At5g11390.1 68418.m01329 expressed protein 31 0.62 At2g35330.1 68415.m04332 zinc finger (C3HC4-type RING finger) pr... 31 0.62 At3g42080.1 68416.m04318 hypothetical protein hypothetical prote... 31 1.1 At1g05320.1 68414.m00539 myosin-related similar to non-muscle my... 31 1.1 At5g66030.2 68418.m08315 Golgi-localized GRIP domain-containing ... 30 1.4 At5g66030.1 68418.m08314 Golgi-localized GRIP domain-containing ... 30 1.4 At5g50230.1 68418.m06221 transducin family protein / WD-40 repea... 29 2.5 At1g29680.1 68414.m03627 expressed protein 29 2.5 At1g24764.1 68414.m03106 expressed protein 29 2.5 At1g22300.3 68414.m02790 14-3-3 protein GF14 epsilon (GRF10) ide... 29 2.5 At1g22300.2 68414.m02789 14-3-3 protein GF14 epsilon (GRF10) ide... 29 2.5 At1g22300.1 68414.m02788 14-3-3 protein GF14 epsilon (GRF10) ide... 29 2.5 At1g03780.2 68414.m00358 targeting protein-related similar to mi... 29 2.5 At1g03780.1 68414.m00359 targeting protein-related similar to mi... 29 2.5 At5g46460.1 68418.m05722 pentatricopeptide (PPR) repeat-containi... 29 3.3 At5g37350.2 68418.m04487 RIO1 family protein similar to extragen... 29 4.4 At5g37350.1 68418.m04486 RIO1 family protein similar to extragen... 29 4.4 At5g16320.1 68418.m01908 expressed protein 29 4.4 At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almos... 28 5.8 At1g32530.1 68414.m04014 zinc finger (C3HC4-type RING finger) fa... 28 5.8 At5g40140.1 68418.m04871 armadillo/beta-catenin repeat family pr... 28 7.6 At5g04140.2 68418.m00402 glutamate synthase (GLU1) / ferredoxin-... 28 7.6 At5g04140.1 68418.m00401 glutamate synthase (GLU1) / ferredoxin-... 28 7.6 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 28 7.6 At1g68910.1 68414.m07886 expressed protein similar to Myosin hea... 28 7.6 >At5g13560.1 68418.m01566 expressed protein weak similarity to SP|O42184 Restin (Cytoplasmic linker protein-170) (CLIP-170) {Gallus gallus} Length = 679 Score = 32.7 bits (71), Expect = 0.27 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +2 Query: 326 ELTKATLTAANEIYKTLKEFSDQVTESHKQAIQATMDVPAVQEKVAAAEESINSITEE 499 E KA + ANE + KE ++ + KQ + D+ V +AAA+ + TEE Sbjct: 332 EALKARVVKANETGEKEKELGAEIAQLEKQRDELEADLKRVNLSLAAAQARFRNATEE 389 >At2g27170.1 68415.m06029 structural maintenance of chromosomes (SMC) family protein similar to basement membrane-associated chondroitin proteoglycan Bamacan [Rattus norvegicus] GI:1785540; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain. No suitalble start codon was identified. Length = 1207 Score = 31.9 bits (69), Expect = 0.47 Identities = 19/85 (22%), Positives = 39/85 (45%) Frame = +2 Query: 248 RSHRQEELNDLLAKLDELQAQAKNDVELTKATLTAANEIYKTLKEFSDQVTESHKQAIQA 427 R+ EE + ++++ Q +K+ E K +YK + Q T++ K+ + Sbjct: 246 RTKASEESTKMYDRVEKAQDDSKSLDESLKELTKELQTLYKEKETVEAQQTKALKKKTKL 305 Query: 428 TMDVPAVQEKVAAAEESINSITEEL 502 +DV Q+++ +S N E+L Sbjct: 306 ELDVKDFQDRITGNIQSKNDALEQL 330 >At5g11390.1 68418.m01329 expressed protein Length = 703 Score = 31.5 bits (68), Expect = 0.62 Identities = 18/79 (22%), Positives = 35/79 (44%) Frame = +2 Query: 266 ELNDLLAKLDELQAQAKNDVELTKATLTAANEIYKTLKEFSDQVTESHKQAIQATMDVPA 445 +L L L + Q ++ V +A+ N +Y T+ + D + + + ++A Sbjct: 466 KLASLEKHLRDSDLQLEHAVAAVEASKEKQNLLYSTVSDMEDVIEDLKSKVLKAENRADI 525 Query: 446 VQEKVAAAEESINSITEEL 502 +EK+ ES + EEL Sbjct: 526 TEEKLIMVSESNAEVNEEL 544 >At2g35330.1 68415.m04332 zinc finger (C3HC4-type RING finger) protein-related contains weak hit to Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger); weak similarity to RING finger protein 8 (Swiss-Prot:O76064) [Homo sapiens] Length = 738 Score = 31.5 bits (68), Expect = 0.62 Identities = 21/87 (24%), Positives = 45/87 (51%), Gaps = 4/87 (4%) Frame = +2 Query: 251 SHRQEELNDLLAKLDELQAQAKNDVELTKAT----LTAANEIYKTLKEFSDQVTESHKQA 418 S + ++ N ++ L+ A+ + ++E +K + LTA E K K+ ++ KQ Sbjct: 476 SGQVDKANAVVRALENESAEIRAEMEASKLSASESLTACMEASKKEKKCLKKLLAWEKQK 535 Query: 419 IQATMDVPAVQEKVAAAEESINSITEE 499 ++ ++ A +EK+ A ++ IT+E Sbjct: 536 MKLQDEITAEKEKIKALNRALAQITQE 562 >At3g42080.1 68416.m04318 hypothetical protein hypothetical proteins - Arabidopsis thaliana Length = 161 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 203 QFRGGHKARSGLAGTRSHRQEELNDLLAKLDEL 301 +F G+KA+ G +H+ EELN+ + +L E+ Sbjct: 84 EFWTGYKAQENTIGKLTHKMEELNNTILELQEM 116 >At1g05320.1 68414.m00539 myosin-related similar to non-muscle myosin II heavy chain (GI:19879404) [Loligo pealei]; ESTs gb|AA042402,gb|ATTS1380 come from this gene Length = 828 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/67 (22%), Positives = 35/67 (52%) Frame = +2 Query: 284 AKLDELQAQAKNDVELTKATLTAANEIYKTLKEFSDQVTESHKQAIQATMDVPAVQEKVA 463 +K D L +QA + + + L + E+ + + E + + ++ ++++ + QEKV+ Sbjct: 139 SKTDALLSQALSQNSVLEQKLKSLEELSEKVSELKSALIVAEEEGKKSSIQMQEYQEKVS 198 Query: 464 AAEESIN 484 E S+N Sbjct: 199 KLESSLN 205 >At5g66030.2 68418.m08315 Golgi-localized GRIP domain-containing protein contains Pfam profile PF01465: GRIP domain; supporting cDNA gi|20303028|gb|AF499634.1| Length = 765 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Frame = +3 Query: 51 ALGLYAEVNTTLLPDIKLNKLHEDSMEM-NRTIDEKSAELDRLIAENEDTLHNLEEGIRR 227 A G+ E+ L + ++ + HE E+ +R I+EK E+ RL+ E + ++E Sbjct: 559 AEGIEKELENAKLRNKRMKEEHESVRELADRLIEEKDREISRLVDEMTNLRKSMESKPVW 618 Query: 228 GRDLLEQGHTGRRNS 272 + + H G N+ Sbjct: 619 NKSPSQVHHYGNNNT 633 >At5g66030.1 68418.m08314 Golgi-localized GRIP domain-containing protein contains Pfam profile PF01465: GRIP domain; supporting cDNA gi|20303028|gb|AF499634.1| Length = 788 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Frame = +3 Query: 51 ALGLYAEVNTTLLPDIKLNKLHEDSMEM-NRTIDEKSAELDRLIAENEDTLHNLEEGIRR 227 A G+ E+ L + ++ + HE E+ +R I+EK E+ RL+ E + ++E Sbjct: 559 AEGIEKELENAKLRNKRMKEEHESVRELADRLIEEKDREISRLVDEMTNLRKSMESKPVW 618 Query: 228 GRDLLEQGHTGRRNS 272 + + H G N+ Sbjct: 619 NKSPSQVHHYGNNNT 633 >At5g50230.1 68418.m06221 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to TIPD PROTEIN (SP:O15736)[Dictyostelium discoideum] Length = 515 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 99 KLNKLHEDSMEMNRTIDEKSAELDRLIAENEDTLHNLEE 215 +L + ED + ++EK+ +D LIAEN + LEE Sbjct: 105 ELTQRREDCTRLQEELEEKTKTVDVLIAENLEIRSQLEE 143 >At1g29680.1 68414.m03627 expressed protein Length = 237 Score = 29.5 bits (63), Expect = 2.5 Identities = 27/96 (28%), Positives = 44/96 (45%), Gaps = 3/96 (3%) Frame = +2 Query: 194 HPSQFR--GGHKARSGLAGTRSHRQEELNDLLAKLDELQAQAKNDVELTKATLTAANEIY 367 H S F GG +R L GT H +ND + + A ++D L ++ +Y Sbjct: 42 HVSTFAIYGGDMSR--LIGTH-HYVHRVNDEFLQC-AVYASDRSDAPLIGIEYVISDRLY 97 Query: 368 KTLKEFSDQVTESHKQAIQA-TMDVPAVQEKVAAAE 472 +TL E ++ SH +++ + P + E VAA E Sbjct: 98 ETLSEDEQKLWHSHAYEVKSGSWAYPRLPEVVAAPE 133 >At1g24764.1 68414.m03106 expressed protein Length = 607 Score = 29.5 bits (63), Expect = 2.5 Identities = 22/87 (25%), Positives = 36/87 (41%), Gaps = 2/87 (2%) Frame = +2 Query: 248 RSHRQEELNDLLAKLDELQAQAKNDVELTKATLTAANEIYKT--LKEFSDQVTESHKQAI 421 R EEL + L KLDE ++ +E + NE K +F+ + T A Sbjct: 111 REKAVEELTEELTKLDEKLKLTESILESKNLEIKKINEEKKASMAAQFAAEATLRRVHAA 170 Query: 422 QATMDVPAVQEKVAAAEESINSITEEL 502 Q D+P ++ +A E + E+ Sbjct: 171 QKDDDMPPIEAILAPLEAELKLARSEI 197 >At1g22300.3 68414.m02790 14-3-3 protein GF14 epsilon (GRF10) identical to 14-3-3 protein GF14 epsilon GI:5802798, SP:P48347 from [Arabidopsis thaliana] Length = 251 Score = 29.5 bits (63), Expect = 2.5 Identities = 22/70 (31%), Positives = 33/70 (47%) Frame = +2 Query: 272 NDLLAKLDELQAQAKNDVELTKATLTAANEIYKTLKEFSDQVTESHKQAIQATMDVPAVQ 451 ND+L+ +D+ + N VE T + Y+ L EFS K+A A + A + Sbjct: 99 NDILSVIDKHLIPSSNAVESTVFFYKMKGDYYRYLAEFSSGA--ERKEA--ADQSLEAYK 154 Query: 452 EKVAAAEESI 481 VAAAE + Sbjct: 155 AAVAAAENGL 164 >At1g22300.2 68414.m02789 14-3-3 protein GF14 epsilon (GRF10) identical to 14-3-3 protein GF14 epsilon GI:5802798, SP:P48347 from [Arabidopsis thaliana] Length = 254 Score = 29.5 bits (63), Expect = 2.5 Identities = 22/70 (31%), Positives = 33/70 (47%) Frame = +2 Query: 272 NDLLAKLDELQAQAKNDVELTKATLTAANEIYKTLKEFSDQVTESHKQAIQATMDVPAVQ 451 ND+L+ +D+ + N VE T + Y+ L EFS K+A A + A + Sbjct: 99 NDILSVIDKHLIPSSNAVESTVFFYKMKGDYYRYLAEFSSGA--ERKEA--ADQSLEAYK 154 Query: 452 EKVAAAEESI 481 VAAAE + Sbjct: 155 AAVAAAENGL 164 >At1g22300.1 68414.m02788 14-3-3 protein GF14 epsilon (GRF10) identical to 14-3-3 protein GF14 epsilon GI:5802798, SP:P48347 from [Arabidopsis thaliana] Length = 254 Score = 29.5 bits (63), Expect = 2.5 Identities = 22/70 (31%), Positives = 33/70 (47%) Frame = +2 Query: 272 NDLLAKLDELQAQAKNDVELTKATLTAANEIYKTLKEFSDQVTESHKQAIQATMDVPAVQ 451 ND+L+ +D+ + N VE T + Y+ L EFS K+A A + A + Sbjct: 99 NDILSVIDKHLIPSSNAVESTVFFYKMKGDYYRYLAEFSSGA--ERKEA--ADQSLEAYK 154 Query: 452 EKVAAAEESI 481 VAAAE + Sbjct: 155 AAVAAAENGL 164 >At1g03780.2 68414.m00358 targeting protein-related similar to microtubule-associated protein / targeting protein for Xklp2 ((TPX2) GI:8926138) {Homo sapiens}; similar to Restricted expression proliferation associated protein 100 (p100) (Differentially expressed in lung cells 2) (DIL-2) (Targeting protein for Xklp2) (C20orf1 protein) (C20orf2 protein) (Protein FLS353)(SP:Q9ULW0) {Homo sapiens} Length = 725 Score = 29.5 bits (63), Expect = 2.5 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = +2 Query: 275 DLLAKLDELQAQAKNDVELTKATLTAANEIYKTLKEFSDQVTESHK-QAIQATMDVPAVQ 451 ++LAK+ + +A+ N E T+ AN+ +T S +V++ H Q T V Sbjct: 345 EMLAKIPKFKARPVNKKEFHLQTMARANQHAETSSIASTEVSKQHNDQKHHLTEPKSPVL 404 Query: 452 EKVAAAEESINSITEEL 502 + + A +I T EL Sbjct: 405 QTMLRARPTIAKTTAEL 421 >At1g03780.1 68414.m00359 targeting protein-related similar to microtubule-associated protein / targeting protein for Xklp2 ((TPX2) GI:8926138) {Homo sapiens}; similar to Restricted expression proliferation associated protein 100 (p100) (Differentially expressed in lung cells 2) (DIL-2) (Targeting protein for Xklp2) (C20orf1 protein) (C20orf2 protein) (Protein FLS353)(SP:Q9ULW0) {Homo sapiens} Length = 687 Score = 29.5 bits (63), Expect = 2.5 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = +2 Query: 275 DLLAKLDELQAQAKNDVELTKATLTAANEIYKTLKEFSDQVTESHK-QAIQATMDVPAVQ 451 ++LAK+ + +A+ N E T+ AN+ +T S +V++ H Q T V Sbjct: 345 EMLAKIPKFKARPVNKKEFHLQTMARANQHAETSSIASTEVSKQHNDQKHHLTEPKSPVL 404 Query: 452 EKVAAAEESINSITEEL 502 + + A +I T EL Sbjct: 405 QTMLRARPTIAKTTAEL 421 >At5g46460.1 68418.m05722 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 697 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 30 ARAVYDEALGLYAEVNTTLLPDIKLNKLHEDSMEM 134 +R V+DE + V T LL LNK HED++ + Sbjct: 279 SRKVFDEKVHEQVAVWTALLSGYSLNKKHEDALSI 313 >At5g37350.2 68418.m04487 RIO1 family protein similar to extragenic suppressor of the bimD6 mutation (SUDD) [Emericella nidulans] GI:2338556, RIO1 [Saccharomyces cerevisiae] GI:1359602; contains Pfam profile PF01163: RIO1 family Length = 385 Score = 28.7 bits (61), Expect = 4.4 Identities = 24/110 (21%), Positives = 49/110 (44%), Gaps = 6/110 (5%) Frame = +2 Query: 311 AKNDVELTKATLTAANE----IYKTLKEFSDQVTESHKQAIQATMDVPAVQEKVAAAEES 478 A N+ E A +T+ + +Y+T+ D + + +Q I+ + +E+ + EES Sbjct: 272 AVNNPEADVAKITSGQDTGDMLYQTITGLKDALPKVDEQQIEVNAEEEEEEEEEGSGEES 331 Query: 479 INSITEELVAPVTRR--RRPGTWPSKRKRNMPTKLLRPPTKSRRKRPLPK 622 +EL P ++ R+ K ++ K P + +RK+ + K Sbjct: 332 EEESEKEL-GPEDKKAARKEHKKKVKEEKRESRKTKTPKSVKKRKKKVSK 380 >At5g37350.1 68418.m04486 RIO1 family protein similar to extragenic suppressor of the bimD6 mutation (SUDD) [Emericella nidulans] GI:2338556, RIO1 [Saccharomyces cerevisiae] GI:1359602; contains Pfam profile PF01163: RIO1 family Length = 531 Score = 28.7 bits (61), Expect = 4.4 Identities = 24/110 (21%), Positives = 49/110 (44%), Gaps = 6/110 (5%) Frame = +2 Query: 311 AKNDVELTKATLTAANE----IYKTLKEFSDQVTESHKQAIQATMDVPAVQEKVAAAEES 478 A N+ E A +T+ + +Y+T+ D + + +Q I+ + +E+ + EES Sbjct: 418 AVNNPEADVAKITSGQDTGDMLYQTITGLKDALPKVDEQQIEVNAEEEEEEEEEGSGEES 477 Query: 479 INSITEELVAPVTRR--RRPGTWPSKRKRNMPTKLLRPPTKSRRKRPLPK 622 +EL P ++ R+ K ++ K P + +RK+ + K Sbjct: 478 EEESEKEL-GPEDKKAARKEHKKKVKEEKRESRKTKTPKSVKKRKKKVSK 526 >At5g16320.1 68418.m01908 expressed protein Length = 470 Score = 28.7 bits (61), Expect = 4.4 Identities = 28/121 (23%), Positives = 46/121 (38%) Frame = +2 Query: 269 LNDLLAKLDELQAQAKNDVELTKATLTAANEIYKTLKEFSDQVTESHKQAIQATMDVPAV 448 + D + L++ K+ E N K+ E SD+ + K I+ D Sbjct: 282 MTDEFEPIPVLKSYIKDCREAALRVCVEDNYSLKSQNEASDKEVSALKPLIKIIKDQNLE 341 Query: 449 QEKVAAAEESINSITEELVAPVTRRRRPGTWPSKRKRNMPTKLLRPPTKSRRKRPLPKQK 628 E +E + EEL R+R T P K++ K K+ + P+P Q+ Sbjct: 342 SE---FTQEKVEERVEELEKNKALRKRNTTNPPKQEPQQKGKKRTRDCKNGSQVPVPSQQ 398 Query: 629 L 631 L Sbjct: 399 L 399 >At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almost identical to CIP1 (GI:836950) [Arabidopsis thaliana] Length = 1305 Score = 28.3 bits (60), Expect = 5.8 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 5/85 (5%) Frame = +2 Query: 260 QEELNDLLAKLD-ELQAQAKNDVELTKATLTAANEIYKTLK----EFSDQVTESHKQAIQ 424 Q EL+ L L+ +L++ +EL+++ L AA E +T+ E SD++ + + Sbjct: 656 QRELSTQLRGLEAQLESSEHRVLELSES-LKAAEEESRTMSTKISETSDELERTQIMVQE 714 Query: 425 ATMDVPAVQEKVAAAEESINSITEE 499 T D ++E++A E + +TE+ Sbjct: 715 LTADSSKLKEQLAEKESKLFLLTEK 739 >At1g32530.1 68414.m04014 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger); weak similarity to interaptin (GI:3549261) [Dictyostelium discoideum] weak similarity to Axoneme-associated protein mst101(2) (Swiss-Prot:Q08696) [Drosophila hydei] Length = 711 Score = 28.3 bits (60), Expect = 5.8 Identities = 20/84 (23%), Positives = 42/84 (50%), Gaps = 4/84 (4%) Frame = +2 Query: 257 RQEELNDLLAKLDELQAQAKNDVELTKAT----LTAANEIYKTLKEFSDQVTESHKQAIQ 424 + + N ++ KL+ A+ + + E +K + L A E K K+ ++ KQ ++ Sbjct: 451 QNDRANVIVRKLENQNAEIRAEREGSKLSASESLKACMEASKKEKKCLKKLVAWEKQILK 510 Query: 425 ATMDVPAVQEKVAAAEESINSITE 496 ++ A +EK+ A +++ ITE Sbjct: 511 LQDEITAEKEKIKALYKTLAQITE 534 >At5g40140.1 68418.m04871 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 550 Score = 27.9 bits (59), Expect = 7.6 Identities = 25/74 (33%), Positives = 36/74 (48%), Gaps = 8/74 (10%) Frame = +2 Query: 350 AANEIYKTLKEFSDQ---VTESHKQAIQATMDVPAVQEKVAAAE-----ESINSITEELV 505 AA ++ L E Q V+ S K+ IQA D P+V+ AA E NS ++E + Sbjct: 136 AAEKLILALMEKKPQRRKVSVSEKELIQAIRDKPSVRLNHAATELDRRPNYFNSSSDESI 195 Query: 506 APVTRRRRPGTWPS 547 A +R + T PS Sbjct: 196 ASSSRTLQLTTKPS 209 >At5g04140.2 68418.m00402 glutamate synthase (GLU1) / ferredoxin-dependent glutamate synthase (Fd-GOGAT 1) identical to ferredoxin-dependent glutamate synthase precursor [Arabidopsis thaliana] GI:3869251 Length = 1648 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +3 Query: 249 GHTGRRNSTISSLSWMSCRR-KLK-TMWNSRKPR*QP 353 GH G N+ +L+WM R LK +WN R+ +P Sbjct: 361 GHNGEINTIQGNLNWMQSREASLKAAVWNGRENEIRP 397 >At5g04140.1 68418.m00401 glutamate synthase (GLU1) / ferredoxin-dependent glutamate synthase (Fd-GOGAT 1) identical to ferredoxin-dependent glutamate synthase precursor [Arabidopsis thaliana] GI:3869251 Length = 1622 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +3 Query: 249 GHTGRRNSTISSLSWMSCRR-KLK-TMWNSRKPR*QP 353 GH G N+ +L+WM R LK +WN R+ +P Sbjct: 335 GHNGEINTIQGNLNWMQSREASLKAAVWNGRENEIRP 371 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +2 Query: 506 APVTRRRRPGTWPSKRKR--NMPTKLLRPPTKSRRKRPLP 619 +P RRRR + P++R+R + P + R PT R+R P Sbjct: 314 SPPARRRRSPSPPARRRRSPSPPARRHRSPTPPARQRRSP 353 >At1g68910.1 68414.m07886 expressed protein similar to Myosin heavy chain, nonmuscle type B (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) (Swiss-Prot:Q27991) [Bos taurus]; contains 1 transmembrane domain Length = 627 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 637 LRDESDKLITRVRSTEKQIEELE 705 L+D DK +V S EKQ+ ELE Sbjct: 390 LKDADDKKTKKVNSLEKQVRELE 412 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,601,870 Number of Sequences: 28952 Number of extensions: 214792 Number of successful extensions: 1004 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1004 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -