BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00596 (544 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 26 0.70 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 25 1.2 AY331408-1|AAQ97589.1| 100|Anopheles gambiae agCP14332 protein. 25 1.6 AY331407-1|AAQ97588.1| 101|Anopheles gambiae agCP14332 protein. 25 1.6 AY331406-1|AAQ97587.1| 96|Anopheles gambiae agCP14332 protein. 25 1.6 AY331405-1|AAQ97586.1| 96|Anopheles gambiae agCP14332 protein. 25 1.6 AY331404-1|AAQ97585.1| 100|Anopheles gambiae agCP14332 protein. 25 1.6 AY331403-1|AAQ97584.1| 103|Anopheles gambiae agCP14332 protein. 25 1.6 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 25 2.1 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 25 2.1 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 24 2.8 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 24 2.8 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 24 2.8 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 2.8 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 3.7 AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-b... 24 3.7 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 3.7 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 23 4.9 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 23 4.9 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 6.5 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 23 6.5 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 6.5 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 8.6 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 26.2 bits (55), Expect = 0.70 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = -2 Query: 423 FPSVNPGISWAPLRTITRAKTERLASTIHPR 331 +P + G + APLR+I + +++A+++HPR Sbjct: 408 WPDLGVG-NMAPLRSIGLTELDQIAASMHPR 437 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 25.4 bits (53), Expect = 1.2 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -3 Query: 176 PFIA*LISLYFGAHALFVKDTKLVLVHHFEQLLASRCRVRNV 51 PFIA + + G L + L+H F QL+A R R RNV Sbjct: 265 PFIADHVLVNVGTVDLLHGRAMIDLIHDFNQLVA-RFRERNV 305 >AY331408-1|AAQ97589.1| 100|Anopheles gambiae agCP14332 protein. Length = 100 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/19 (63%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 279 PFDIRRRTRC--LSGRPVS 229 P ++RRRTRC L G PVS Sbjct: 52 PGNVRRRTRCGSLCGSPVS 70 >AY331407-1|AAQ97588.1| 101|Anopheles gambiae agCP14332 protein. Length = 101 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/19 (63%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 279 PFDIRRRTRC--LSGRPVS 229 P ++RRRTRC L G PVS Sbjct: 52 PGNVRRRTRCGSLCGSPVS 70 >AY331406-1|AAQ97587.1| 96|Anopheles gambiae agCP14332 protein. Length = 96 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/19 (63%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 279 PFDIRRRTRC--LSGRPVS 229 P ++RRRTRC L G PVS Sbjct: 52 PGNVRRRTRCGSLCGSPVS 70 >AY331405-1|AAQ97586.1| 96|Anopheles gambiae agCP14332 protein. Length = 96 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/19 (63%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 279 PFDIRRRTRC--LSGRPVS 229 P ++RRRTRC L G PVS Sbjct: 52 PGNVRRRTRCGSLCGSPVS 70 >AY331404-1|AAQ97585.1| 100|Anopheles gambiae agCP14332 protein. Length = 100 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/19 (63%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 279 PFDIRRRTRC--LSGRPVS 229 P ++RRRTRC L G PVS Sbjct: 52 PGNVRRRTRCGSLCGSPVS 70 >AY331403-1|AAQ97584.1| 103|Anopheles gambiae agCP14332 protein. Length = 103 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/19 (63%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 279 PFDIRRRTRC--LSGRPVS 229 P ++RRRTRC L G PVS Sbjct: 53 PENVRRRTRCGSLCGSPVS 71 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 24.6 bits (51), Expect = 2.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 156 QPLLRRPCAFRKRYEACAR 100 Q +RR CAF K++EA R Sbjct: 379 QAHIRRHCAFAKQFEALCR 397 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 24.6 bits (51), Expect = 2.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 156 QPLLRRPCAFRKRYEACAR 100 Q +RR CAF K++EA R Sbjct: 410 QAHIRRHCAFAKQFEALCR 428 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 24.2 bits (50), Expect = 2.8 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 425 VPRRLGPKRASKIRKLFNLSKEDACTSLVV 514 + R LGP+ I +F+L+ AC VV Sbjct: 259 ISRSLGPEFGGSIGLIFSLANAVACAMYVV 288 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.2 bits (50), Expect = 2.8 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 204 RQRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGIP 70 +Q+ ++HS + + RRP + + P L TTSG P Sbjct: 25 QQQQQLHSADVPHSSTSQSSRRPQHSSTSASSSSVPTLPTTSGEP 69 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.2 bits (50), Expect = 2.8 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 204 RQRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGIP 70 +Q+ ++HS + + RRP + + P L TTSG P Sbjct: 25 QQQQQLHSADVPHSSTSQSSRRPQHSSTSASSSSVPTLPTTSGEP 69 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.2 bits (50), Expect = 2.8 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = -3 Query: 440 LDGGVHFHQSIQEFPGHPCAQ*QEPRPRDWRQQYIHELIYVFSLHRGAVCNMSGPLTSED 261 +DGG++ S++ FPG+ + + + + ++F LH V N L ED Sbjct: 167 VDGGLNIPHSVKRFPGYSAEN------KSFNAEMHRD--HIFGLH---VANYMRTLEEED 215 Query: 260 EHA 252 E A Sbjct: 216 EEA 218 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.8 bits (49), Expect = 3.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 370 SCYCAQGCPGN 402 +CYC CPGN Sbjct: 73 TCYCEGHCPGN 83 >AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-binding protein OBPjj2 protein. Length = 228 Score = 23.8 bits (49), Expect = 3.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 232 FIGNPCLSLPPATRS 188 F GNPCL PP ++ Sbjct: 55 FAGNPCLKGPPVPKN 69 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 3.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 59 VPGNGMPEVVRSGGRAQA 112 VPG+G+P SGG A Sbjct: 3225 VPGSGLPAAAASGGAPSA 3242 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 23.4 bits (48), Expect = 4.9 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = +2 Query: 182 LCTSCRWRQRQARIPDETGRPDKQRVRLLMSKGHSCYRPRRDGERKRKSVRGCIVDANLS 361 +CTSC WR +A RP +L ++G RP R+S R CI+ +L+ Sbjct: 1 MCTSCAWRCARA----SPSRP------ILTTRGRRWPRPPTSCWPSRRS-RLCIIALSLT 49 Query: 362 V 364 + Sbjct: 50 L 50 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.4 bits (48), Expect = 4.9 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = +2 Query: 230 ETGRPDKQRVRLLMSKGHSCYRPRRDGERKRKSVR 334 E P++QR + +GH + R +R++ +R Sbjct: 468 EKAAPERQRCYRCLERGHLAHACRSSTDRQQLCIR 502 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 6.5 Identities = 13/47 (27%), Positives = 17/47 (36%) Frame = -3 Query: 362 PRDWRQQYIHELIYVFSLHRGAVCNMSGPLTSEDEHAVCQDALFHRE 222 P + + Y ELI H A+ T D C+D F E Sbjct: 319 PNNNKATYEKELIASVQFHTCAITEKEVQFTKGDVDFACEDERFSAE 365 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.0 bits (47), Expect = 6.5 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 380 VRKGAQEIPGLTDGNVPRRLGPKRASKIRKLFNLSK 487 V GAQ++ G G P + PK IR SK Sbjct: 199 VYTGAQKVLGAPPGITPISISPKALDVIRNRRTKSK 234 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 6.5 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -3 Query: 365 RPRDWRQQYIHELIYVFSLHRGAVCNMSGPLTSED 261 +P+D+R+ + L VF +GA+ ++ T ED Sbjct: 856 KPKDFRKHSLLPLNNVFDRIKGALPHLKKSPTKED 890 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 22.6 bits (46), Expect = 8.6 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +2 Query: 197 RWRQRQARIPDETGRPDKQRVRLLMSKGHSCYRPRRDGERKRK 325 R QRQAR PD+Q+ +S R RR+ ER R+ Sbjct: 1162 RQAQRQARAHM---LPDRQQNGRAVSSAEELERRRREMERTRR 1201 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 620,143 Number of Sequences: 2352 Number of extensions: 13584 Number of successful extensions: 44 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50040333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -