BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00595 (784 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 24 1.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 5.6 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 22 7.4 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.8 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 9.8 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 23.8 bits (49), Expect = 1.8 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Frame = -1 Query: 247 YRVSEVVNCNDLMTGFQQC----DYAMTSYVSAPPVTNMFLN-RGII 122 Y V E VN DLM QQC + Y S + FL+ RGI+ Sbjct: 61 YFVMEYVNGGDLMYQIQQCGKFKEPVAVFYASEIAIGLFFLHGRGIV 107 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 732 LVGSSPISPEGCAPTG*NTG 673 ++ +SP+ EG PTG TG Sbjct: 387 IILASPLKREGGPPTGATTG 406 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 238 SEVVNCNDLMTGFQ 197 S++ NCN LMT F+ Sbjct: 179 SDLDNCNHLMTKFE 192 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +2 Query: 683 QPVGAHPSGLIGEDPTKE 736 QP HP L+G++ K+ Sbjct: 107 QPYRPHPHNLVGKEACKQ 124 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +2 Query: 683 QPVGAHPSGLIGEDPTKE 736 QP HP L+G++ K+ Sbjct: 107 QPYRPHPHNLVGKEACKQ 124 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,992 Number of Sequences: 438 Number of extensions: 4274 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -