BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00593 (786 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 25 0.91 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 8.4 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 8.4 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 24.6 bits (51), Expect = 0.91 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 299 MERMLQPCGPPPEKPED 349 ME L PC P KP+D Sbjct: 126 METTLTPCASPNRKPDD 142 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 764 QIHIKHYRLLRLSV 723 Q+ +HYRL +LSV Sbjct: 143 QLRYEHYRLYQLSV 156 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/34 (23%), Positives = 18/34 (52%) Frame = +1 Query: 547 YSLELVQWSNV*QSYFYIQTCFILFYLKEISFDF 648 Y L + ++N + Y+++ C + + I F+F Sbjct: 41 YLLTNLTYNNTNRKYYWLNVCCLNLSIVTIFFNF 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,337 Number of Sequences: 336 Number of extensions: 3728 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -