BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00593 (786 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 29 4.3 SB_29128| Best HMM Match : Ank (HMM E-Value=2.9e-19) 29 4.3 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 141 SKYIGTGHADTTKYEWLMNQHRDSCCSYMGHPDLLSY 251 S + GH YE M QH S C Y D + Y Sbjct: 887 SLWADQGHCKNVVYEDFMKQHCKSTCGYCACKDAIKY 923 >SB_29128| Best HMM Match : Ank (HMM E-Value=2.9e-19) Length = 454 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +1 Query: 520 LQILITGIVYSLELVQWSNV*QSYFYIQTCFILFYLKEISFDFHLALYI 666 L++L TGI+Y L +W+ + FY + F + YL F LA+Y+ Sbjct: 364 LEMLNTGIMYRLLEEKWNAFAKRKFYTRMLFAVLYL----ICFSLAIYL 408 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,881,441 Number of Sequences: 59808 Number of extensions: 398357 Number of successful extensions: 715 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 715 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -