BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00592 (772 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50883| Best HMM Match : MAM33 (HMM E-Value=1.7e-23) 42 6e-04 SB_44872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 >SB_50883| Best HMM Match : MAM33 (HMM E-Value=1.7e-23) Length = 200 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = +3 Query: 45 MNLLEEKGISNEFVQKLSDFSTAYEHTAYINLLESISKF 161 +N+L E+G+ N F L DFSTA EH YI L+++ F Sbjct: 158 LNMLAERGVDNSFGHWLLDFSTAIEHQHYIKFLKNLQGF 196 >SB_44872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 28.7 bits (61), Expect = 5.5 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +1 Query: 211 NISFF-FKYLVSNYIILFASSVQLKFRKSNCYRSNNSTFII 330 N+ F F Y S II + K RK C +NN+ FI+ Sbjct: 514 NVKLFNFLYFSSICIIFTRDHIDRKLRKGLCIPANNTIFIV 554 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,447,318 Number of Sequences: 59808 Number of extensions: 378201 Number of successful extensions: 734 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -