BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00592 (772 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66440.1 68414.m07548 DC1 domain-containing protein contains ... 29 4.5 At3g56980.1 68416.m06342 basic helix-loop-helix (bHLH) family pr... 28 5.9 >At1g66440.1 68414.m07548 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 726 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 400 LLLLIEDLKSTNAAQCNCQNSRHLL*MYYCWIC 302 L L++E+ +C C + L YYCW+C Sbjct: 236 LQLILENSWGCRKKKCYCCDEILLWIFYYCWVC 268 >At3g56980.1 68416.m06342 basic helix-loop-helix (bHLH) family protein Length = 258 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 675 INLKSHK*SNFSLNCSEY*HRLLYLF 752 ++L+ K N+ LNC E R+LYL+ Sbjct: 225 LHLQVEKIENYKLNCEELSQRMLYLY 250 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,358,573 Number of Sequences: 28952 Number of extensions: 269176 Number of successful extensions: 516 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 516 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -